CAZyme Information: KAG6620055.1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: KAG6620055.1
• CAZy Family: GT71
• CAZyme Description: Inositol phosphoceramide mannosyltransferase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378		42581.07	5.9123

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiGKB4	19981	N/A	0	19981

• Gene Location: location=JAFJYM010000011:146867-150451(-)

Full Sequence      

MTQSGLEIIHPWSWMSASLPKSLFLALMALSVVGVLVTTSRVGSFLQVDHSQTSVPAAAG
KANRLSFRAVGQGVALLDADGTNASLSATEPTIPHIIHQSWKSTDKIPTRFFPWMRSWLE
FNPTWTYLFWTDEDNLQLFEHLYPQYLHVAKSVQKVALADMARYALLHSVGGLYIDADFE
CLKPFEKLHRANRIFLSTEPLAHSVLLEGGASAALCNALMASVPGHPFWLHVLDNIKDKF
DRGDEVGDPVSLTGPRIVKETYLASTSEEAVEVIVFPPEYFYPDIAHWNSEPFDAACRTR
DDAAAKEACEWMQKFPNGEYTNNTHAVHHWQCTWCRDAKLKEYGSSTTSFNARDASEHFI
YWCDAHPYSSGADFWNFW

Enzyme Prediction     

No EC number prediction in KAG6620055.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	115	190	1.5e-16	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	3.33e-18	75	283	64	254	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	2.81e-09	116	188	9	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKS49121.1|GT2|GT32|GT62	7.71e-34	93	348	9	250
AWB08093.1|GT2|GT32|GT62	1.04e-33	93	338	9	236
ADI10024.1|GT2|GT32|GT62	1.48e-33	93	337	7	227
CBS91531.1|GT2|GT32|GT62	9.88e-32	93	344	9	246
AQW50986.1|GT2|GT32|GT62	1.02e-31	93	337	7	227

PDB Hits     

KAG6620055.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38287|CSH1_YEAST	3.32e-15	80	237	48	194	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	3.37e-13	93	236	57	188	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	4.20e-13	90	237	79	214	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|O14084|IMT1_SCHPO	1.52e-12	93	236	64	199	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|Q5UQW4|YL373_MIMIV	1.20e-07	93	283	2	185	Uncharacterized glycosyltransferase L373 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_L373 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000036	0.000013

TMHMM  Annotations     

There is no transmembrane helices in KAG6620055.1.