CAZyme Information: KAG6619860.1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: KAG6619860.1
• CAZy Family: GT71
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
264	JAFJYM010000011|CGC2	30737.43	7.8170

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiGKB4	19981	N/A	0	19981

• Gene Location: location=JAFJYM010000011:294474-295363(-)

Full Sequence      

MKHDLENGGVHYPRNKPLARFLRVISERSWFVRLTLFLLYFMLAVVVVNTGLSMMTTRPQ
MFHVRGDKFDHSVSRDKAIVMCMHDGVVPMGLSLVRELRCLGNREFIQVYHCLPDELSNK
SRALLFEADSRLEIVDVCSDLVERGEMNIELARQFRNWWIKPLALYHSDATEVILLDVDD
LFMRDPAVLRTTEGYKRTGTTFFYDRVIDGKFFFNQEMVNNRSYLDNLLHGFNYSSIGVS
SGYTPSAHLRKSFAFRGAFQEQWI

Enzyme Prediction     

No EC number prediction in KAG6619860.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	79	219	2.2e-23	0.5189393939393939

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	6.48e-10	77	208	2	131	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAP68847.1|GT71	6.24e-61	72	257	58	251
CCA15193.1|GT71	5.85e-57	73	255	128	316
CCA22801.1|GT71	6.21e-42	79	257	61	237
AIG56397.1|GT71	1.80e-36	77	239	92	256
AIG56246.1|GT71	5.13e-34	77	258	65	248

PDB Hits     

KAG6619860.1 has no PDB hit.

Swiss-Prot Hits     

KAG6619860.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000004	0.000005

TMHMM  Annotations     

Start	End
30	52