CAZyme Information: KAG6619580.1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: KAG6619580.1
• CAZy Family: GT71
• CAZyme Description: Inositol phosphoceramide mannosyltransferase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365		40821.19	5.5050

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiGKB4	19981	N/A	0	19981

• Gene Location: location=JAFJYM010000012:153145-154242(-)

Full Sequence      

MSASLPKSLFLALMALSVVGVLVTTSRVGSFLQVDHSQTSVPAAAGKANRLSFRAVGQGV
ALLDADGTNASLSATEPTIPHIIHQSWKSTDKIPTRFFPWMRSWLEFNPTWTYLFWTDED
NLQLFEHLYPQYLHVAKSVQKVALADMARYALLHSVGGLYIDADFECLKPFEELHRANRI
FLSTEPLAHSVLLEGGASAALCNALMASVPGHPFWLHVLDNIKDKFDRGDEVGDPVSLTG
PRIVKETYLASTSEEAVEVIVFPPEYFYPDIAHWNSEPFDAACRTRDDAAAKEACEWMQK
FPNGEYTNNTHAVHHWQCTWCRDAKLKEYGSLDDIFSTPVMRPNISSTGVTLTPYSSGAD
FWNFW

Enzyme Prediction     

No EC number prediction in KAG6619580.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	101	176	1.3e-16	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.05e-18	61	269	64	254	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.88e-09	102	174	9	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDZ26039.1|GT32	2.80e-36	76	320	11	288
UPR05240.1|GT32	1.49e-35	76	320	11	288
ADI10024.1|GT2|GT32|GT62	2.42e-34	79	323	7	227
AWB08093.1|GT2|GT32|GT62	5.70e-34	79	324	9	236
QKS49121.1|GT2|GT32|GT62	1.43e-33	79	324	9	240

PDB Hits     

KAG6619580.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38287|CSH1_YEAST	2.93e-15	66	223	48	194	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	3.03e-13	79	222	57	188	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	3.79e-13	76	223	79	214	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|O14084|IMT1_SCHPO	1.39e-12	79	222	64	199	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|Q5UQW4|YL373_MIMIV	4.63e-08	79	269	2	185	Uncharacterized glycosyltransferase L373 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_L373 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.833009	0.166998

TMHMM  Annotations     

There is no transmembrane helices in KAG6619580.1.