CAZyme Information: KAG6618723.1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: KAG6618723.1
• CAZy Family: GT62
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
694	JAFJYM010000015|CGC1	78752.87	9.4908

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiGKB4	19981	N/A	0	19981

• Gene Location: location=JAFJYM010000015:1486590-1488674(+)

Full Sequence      

MLGHVRGEGRGGRRPQPRIVGWVTVLLLLALSASCGWYSQQVITVSYEGEHEISSVAHEV
IVRRQQLLAKLTAHAGGSGSSVPSKMMLEPLELSTDASQDKAIAFIIDPMKDAPQDNPED
TPKPTEKKTEPPPQETTSPPTPAPTPKPSAAPEPSSKPPTPAPSTSAPTKTSAPNETPKP
QPDPNMEKLWDPVKTLSELDEYECVAWRQTANCSPRGALKPKRDAGCDRVILPSDSGFCE
YRHRKTGELRRIIAAKCKSRASQMEYSCANATMLVRYNLMADDYKPNYPLSFDNNKRDFL
RQNGLAKDNSSKAVVVNGHKIEAPTSFTQGIAYVVYEQLFLSVYAAIRALRSTGCTLPIE
LWYREEETNTSHPLLQELTTKYGAYLRIIKDPRAVKFYTKLYAVFYSAFDNLLLLDADNF
AARDPTHLFTTEVYNDTGAVFWPDYWMPNRTIFKTKKNSDLWNLMGVPFVDMFEQESGQV
LVNRPKHTKALHTLLHYGLTEPHLPAEFDMLWGDKDLFRFAWMRTNSSFHMIKRPAGSAG
LKAPHLNIFCGNTMVQHDPDGEIAFLHRNIVKFLREGNNTQKLWQYVQQYNMNQDLRYYE
VRGDVDHRWFPSIRKCYGRRINYLRAYSLKPITDFPFAGLEDEIISHVQEGVEIIKVSGY
KSTPEPPATLSPNKARKQRQRRRKVKKAKKDKKK

Enzyme Prediction     

No EC number prediction in KAG6618723.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	329	558	9.2e-48	0.9924242424242424

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	8.38e-36	330	558	3	273	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
223880	TonB	9.71e-05	88	184	26	121	Periplasmic protein TonB, links inner and outer membranes [Cell wall/membrane/envelope biogenesis].
399942	SRA1	0.002	150	192	1	43	Steroid receptor RNA activator (SRA1). This family consists of several hypothetical mammalian steroid receptor RNA activator proteins. SRA-RNAs likely to encode stable proteins are widely expressed in breast cancer cell lines. SRA-RNA is a steroid receptor co-activator which acts as a functional RNA and is classified as belonging to the growing family of functional non-coding RNAs.
411408	PspC_subgroup_2	0.002	119	188	281	338	pneumococcal surface protein PspC, LPXTG-anchored form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site. The other form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A.
411408	PspC_subgroup_2	0.003	50	188	219	360	pneumococcal surface protein PspC, LPXTG-anchored form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site. The other form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ24000.1|GT71	1.91e-144	202	662	104	578
UIZ24059.1|GT71	1.41e-139	194	661	133	605
CCA25989.1|GT71	4.02e-118	194	650	88	538
CCA20051.1|GT71	3.29e-116	190	655	78	537
AIG56191.1|GT71	9.87e-91	185	654	26	489

PDB Hits     

KAG6618723.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38069|MNN2_YEAST	2.70e-15	330	558	172	440	Alpha-1,2-mannosyltransferase MNN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN2 PE=1 SV=1
sp|Q59KJ7|MNN21_CANAL	1.12e-13	300	566	215	534	Alpha-1,2-mannosyltransferase MNN21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN21 PE=3 SV=1
sp|Q5AP90|MNN23_CANAL	3.49e-11	344	559	189	450	Alpha-1,2-mannosyltransferase MNN23 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN23 PE=3 SV=2
sp|Q59WF4|MNN2_CANAL	1.04e-10	344	573	202	485	Alpha-1,2-mannosyltransferase MNN2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN2 PE=1 SV=2
sp|A6ZQE9|MNN5_YEAS7	1.79e-10	322	533	143	409	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=MNN5 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.326036	0.673964	CS pos: 34-35. Pr: 0.6158

TMHMM  Annotations     

There is no transmembrane helices in KAG6618723.1.