CAZyme Information: KAG6618450.1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: KAG6618450.1
• CAZy Family: GT50
• CAZyme Description: Glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
462		49269.25	4.1010

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiGKB4	19981	N/A	0	19981

• Gene Location: location=JAFJYM010000015:870579-872117(+)

Full Sequence      

MFVLNEGLLVINRIGLHFFYPNDDSSVASPSPPAETIELVVQGLWPSAISIGNAMDLFTT
YDINVLQLLLAMDSVMDDPTVKSTQTGGSPSLAGKPHRIEASEPDFLDIAVSDDITPALQ
KLATRYCEDPGAWNVFAIDIKNEPKGTATWGKGDEDTDWNLQAATIGNAVIKMCPRLLVF
VEGVQTNIKGVSLEWGQAGGSLHGAKNYPVKLSNMVRLVYGPHLMSPGVDYKAPWWSNSN
FPDNMPSTLASYRRKLSIGSFYWASNLQPADTGGFVKGDWVTAIDERVALLESLPTTSVE
DIVAIYAKCTKTCAGNGGCEGGKCVCYTGWSGPQCEICSEGDTGACNDMRTCLGNSTCAC
DDDADGKYCAGTDCDEVDCGDGSNAGCFNDEWTCRYYCIGNSCTACAANESALADASNGA
TILCDACDAQAIHDYSSAVTSSTVTFGSTSFAVITMLFTCFF

Enzyme Prediction     

No EC number prediction in KAG6618450.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	113	247	2.7e-32	0.4064516129032258

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	7.13e-08	96	256	85	224	Cellulase (glycosyl hydrolase family 5).
225344	BglC	2.43e-07	110	252	160	304	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ24085.1|GH5_1	5.27e-214	34	454	49	521
UGY90949.1|GH5_1	2.41e-30	121	293	208	410
UMV49975.1|CBM3|GH5_1	4.88e-29	122	317	175	402
AKG24820.1|CBM2|GH5_1	7.86e-29	120	296	188	398
AFZ20162.1|CBM2|GH5_1	1.27e-28	122	294	180	386

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1ECE_A	7.55e-26	119	282	141	338	Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus],1ECE_B Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus]
1VRX_A	2.62e-25	119	302	141	358	Chain A, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus],1VRX_B Chain B, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus]
3VVG_A	6.35e-25	133	294	158	375	The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_B The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_C The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3W6L_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
3W6M_A	6.35e-25	133	294	158	375	Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
3QHM_A	1.12e-24	133	294	191	408	Crystal analysis of the complex structure, E342A-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHM_B Crystal analysis of the complex structure, E342A-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHM_C Crystal analysis of the complex structure, E342A-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P23548|GUN_PAEPO	1.04e-25	122	282	176	369	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2
sp|P54583|GUN1_ACIC1	2.48e-24	119	282	182	379	Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) OX=351607 GN=Acel_0614 PE=1 SV=1
sp|P19487|GUNA_XANCP	9.41e-20	119	294	161	368	Major extracellular endoglucanase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=engXCA PE=1 SV=2
sp|P04956|GUNB_ACET2	1.46e-06	122	236	186	323	Endoglucanase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998271	0.001730

TMHMM  Annotations     

There is no transmembrane helices in KAG6618450.1.