CAZyme Information: KAG6617313.1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: KAG6617313.1
• CAZy Family: GT4
• CAZyme Description: Glucan 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
752	JAFJYM010000017|CGC3	82361.33	7.2926

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiGKB4	19981	N/A	0	19981

• Gene Location: location=JAFJYM010000017:853229-856904(-)

Full Sequence      

MGLIDAAFAGDLRAARQTIANGCILDERGANESTAVMEAARMGHVDVLTFLLTSGASVNL
VNFEGHTPLRLAVDRQQLQTVKVLLAFDANVELGDTLGTTPLMATAKRGFAVLAELLIDA
APNSVRAIDKNGDSALTIAAYNGHLEIVRLLLSGSVSVSLSNGGAPTPLMLAATKGHVKV
MAVGRRLYERCWSMERKLIGTEWVPPLWQQRLKTATLSSSLRLHRVLASSEAAEACAASG
AYCGNDQSGPNCCTPGNYCQPWNPTYYQCRPTPARCGTPEVGIDYNGADIADLTGMKLSD
DCCNRCASTAGCAAYTFVNNGWDGQPHCYLKSGTGTRKKAVGVVSAVVSSSSTPRATNTT
GGHIQAQIRSGAVKSRAVNLGGWLVTEHWITWESALWNGISRDEDHKGEYHTMQILDKEK
GTVAFEQHRKTWITEADIKEIADTGVLNTVRVPVGHWIIRDATTAPGTEGDMFARGGLKY
LDALINDWAVKYNIAVMISLHAHQGSQNGIEHSAPVTLNTVGWSTSQVNVDNSLKFATFL
AARYKNSPAFLGLNLMNEPVPPVDGNALRNYYIDAYKQIRATGNDCILLVTPFLNDQDPD
HLKGMIGAPEYTNVWNEIHAYFIWGYEGKTEEQVLAVIDQYDQSHLKAAPTNNRLFLGEW
CMGGPPDSRGIFQNIDNFRELGRKQLAYFNADTTGGWAFWTWRNSDETVKRTGWSMRYLI
RKWIPQVCCLRIGFKGSRKCRGKTIRDDDTEL

Enzyme Prediction     

No EC number prediction in KAG6617313.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	426	707	8.1e-44	0.9711191335740073

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	5.51e-24	376	720	19	376	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
293786	ANK	1.36e-20	31	123	1	95	ankyrin repeats. Ankyrin repeats are one of the most abundant repeat motifs, and generally function as scaffolds for protein-protein interactions in processes including cell cycle, transcriptional regulation, signal transduction, vesicular trafficking, and inflammatory response. Although predominantly found in eukaryotic proteins, they are also found in some bacterial and viral proteins. Less is known of their physiological roles in prokaryotes. Some bacterial ANK proteins play key roles in microbial pathogenesis by mimicking or manipulating host function(s). The pathogen Providencia alcalifaciens N-formyltransferase ankyrin repeats function in small molecule binding and allosteric control. Ankyrin-repeat proteins have been associated with a number of human diseases.
293786	ANK	1.23e-19	3	95	6	98	ankyrin repeats. Ankyrin repeats are one of the most abundant repeat motifs, and generally function as scaffolds for protein-protein interactions in processes including cell cycle, transcriptional regulation, signal transduction, vesicular trafficking, and inflammatory response. Although predominantly found in eukaryotic proteins, they are also found in some bacterial and viral proteins. Less is known of their physiological roles in prokaryotes. Some bacterial ANK proteins play key roles in microbial pathogenesis by mimicking or manipulating host function(s). The pathogen Providencia alcalifaciens N-formyltransferase ankyrin repeats function in small molecule binding and allosteric control. Ankyrin-repeat proteins have been associated with a number of human diseases.
403870	Ank_2	2.33e-13	69	149	1	78	Ankyrin repeats (3 copies).
403870	Ank_2	3.79e-12	3	95	1	91	Ankyrin repeats (3 copies).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAM18484.1|GH5	4.31e-103	364	727	9	370
UIZ29723.1|GH5	2.74e-102	366	721	3	356
CCA15861.1|GH5	6.77e-100	365	724	13	371
CCA15900.1|GH5	6.55e-96	363	721	101	448
AIG55478.1|GH5	2.98e-92	362	727	13	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2PC8_A	3.54e-31	376	706	16	369	Chain A, Hypothetical protein XOG1 [Candida albicans]
1EQP_A	4.33e-31	376	706	10	363	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
2PF0_A	6.46e-31	376	706	16	369	Chain A, Hypothetical protein XOG1 [Candida albicans]
1CZ1_A	7.90e-31	376	706	10	363	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	8.73e-31	376	706	16	369	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q96V64|EXG_BLUGR	2.46e-34	374	728	36	416	Glucan 1,3-beta-glucosidase OS=Blumeria graminis OX=34373 PE=3 SV=1
sp|Q12626|EXG_PICAN	4.32e-33	374	720	48	414	Glucan 1,3-beta-glucosidase OS=Pichia angusta OX=870730 PE=3 SV=1
sp|Q12700|EXG_SCHOC	2.72e-30	374	703	41	392	Glucan 1,3-beta-glucosidase OS=Schwanniomyces occidentalis OX=27300 PE=3 SV=1
sp|P29717|EXG1_CANAL	4.45e-30	376	706	54	407	Glucan 1,3-beta-glucosidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=XOG1 PE=1 SV=5
sp|Q5B5X8|EXGA_EMENI	7.22e-29	372	726	26	392	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000050	0.000006

TMHMM  Annotations     

There is no transmembrane helices in KAG6617313.1.