CAZyme Information: KAG6616063.1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: KAG6616063.1
• CAZy Family: GT20
• CAZyme Description: putative polygalacturonase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380		39736.12	10.0476

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiGKB4	19981	N/A	0	19981

• Gene Location: location=JAFJYM010000022:3159477-3160685(-)

Full Sequence      

MKFFTTALAVFALIATTANGSPMLRMEAEGKKGKSKTEAPVQSPTTKTSSGCHLTGTYKK
GTSIASCSSIVIDSLTVPAGVTLDLSLAKTGATIEFVGTTTFGTQKWEGPLVRVSGTSLT
VKGSGVLDGQGSWYWKQGQSITRPVFFKLQNVISSTVSGFTIKNMPFRTFSIVTSKDTTL
RGLTIDNRAGNGIAKNTDGFDLTKNDHITITGNKIYNQDDCLAMQSSTNTVFSNNYCCGG
HGISIGSLGGNAVDQSTTVQGLTVQGNTIVDSDNGIRIKTIIGLKGLVSDVKYVQNTLSN
VKNAIVMHSDYSKAKGGYTGSPTSQVTIKGVTVNGLKGTATNLYDIVANPKVVSGWDFSG
VTVSASVKGKLAGAPNSMSV

Enzyme Prediction     

EC	3.2.1.15:10

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	64	370	2.5e-62	0.9353846153846154

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	6.66e-75	67	364	1	304	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
177865	PLN02218	4.71e-25	34	349	55	391	polygalacturonase ADPG
227721	Pgu1	2.20e-22	62	302	104	399	Polygalacturonase [Carbohydrate transport and metabolism].
215540	PLN03010	3.97e-22	107	349	124	357	polygalacturonase
215426	PLN02793	1.30e-21	55	340	69	368	Probable polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKP15054.1|GH28	2.11e-268	1	380	1	380
UKP15055.1|GH28	8.16e-260	1	380	1	402
AAN05466.1|GH28	3.50e-257	1	380	1	414
UKP15058.1|GH28	4.97e-257	1	380	1	414
AAN05467.1|GH28	4.62e-246	1	380	1	414

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KVE_A	1.15e-68	52	368	11	331	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
6KVH_A	1.15e-68	52	368	11	331	Chain A, endo-polygalacturonase [Evansstolkia leycettana]
2IQ7_A	1.56e-67	65	368	16	324	Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_B Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_C Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_D Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_E Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_F Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_G Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini]
7E56_A	2.84e-67	52	368	3	323	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
1NHC_A	4.22e-63	50	364	1	319	Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_B Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_C Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_D Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_E Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_F Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P26215|PGLR_COCCA	9.98e-75	51	368	29	351	Polygalacturonase OS=Cochliobolus carbonum OX=5017 GN=PGN1 PE=3 SV=1
sp|B8N8M2|PGLR1_ASPFN	1.54e-74	50	368	32	354	Probable endopolygalacturonase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pgaI PE=3 SV=1
sp|P41750|PGLRB_ASPFA	1.54e-74	50	368	32	354	Endopolygalacturonase B OS=Aspergillus flavus (strain ATCC MYA-384 / AF70) OX=1392242 GN=pgaB PE=2 SV=2
sp|Q2UHL4|PGLR1_ASPOR	1.54e-74	50	368	32	354	Endopolygalacturonase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pgaI PE=1 SV=1
sp|Q12708|PGLR1_SCLSC	2.40e-70	65	376	62	376	Endo-polygalacturonase OS=Sclerotinia sclerotiorum OX=5180 GN=PG1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000285	0.999709	CS pos: 20-21. Pr: 0.9825

TMHMM  Annotations     

There is no transmembrane helices in KAG6616063.1.