CAZyme Information: KAG6613587.1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: KAG6613587.1
• CAZy Family: GH7
• CAZyme Description: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
947		107354.19	5.3573

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiGKB4	19981	N/A	0	19981

• Gene Location: location=JAFJYM010000034:72258-75704(+)

Full Sequence      

MWRALGVCACVCVALAAALSPGFNAPMPYYTYPLLEILHPLNDMLLAQTELQVEIEVRAE
LLSGGLQRSRVCVLMQPAYVPPDVALDPGAGELDESCFDQSLNYTTFHVAGLVPGLSYAL
TVGLETNGNMVALSSRTFSVGSILLPGVDGRLSVDDALEAGAQLHNARDRATASRIYRYV
LEIFPDHPQAQHLLGLALYQDGETDRALPYLQRAVQANESDENFHNSLGICLKSLGRVDE
AVRHYRRALELNPMQVQASINLGDAMQSQGKWEEALKEYTKVAKIPMHVLESHTEPGKAE
HLAKDATGRRCELIRVTDGWYHADRCLNDALERWPDEPVFHNDRGNLLANAGQFETALDE
YQRSSDLGLLAGKLNLADTLEALGETQKCIDMYDQILGKEILDRFHPRTRIMVMKATVLP
RVLPSTQKEIDDSRDRFEREVEALLLNLDSLEKTEVDPNRVSLSTGITLTAHNRNNRELK
AAMGYLYWQLLYQRRMVREDYVASYGIVPLPYTQRSEDINRPAIGPRRLRVGFVSRYIFN
SAVGLYMSELIPMFDREKYEIIVFAIAQSKSMKVVKEIEAITETIIALPKDVRIAREEIR
AWHMDVLIYPELGMDKTTYFVSLDRLAKVQAVWWGNADTSGVPTMDYYLTSEHEHPNFNS
HYSEAVYQFRGMGIFHKLPDLPKKSINRDQVRRAIEERFDIPSDFHFYLAIESIIHIHPD
FDAAVAKIFEADKKAHFFLLSTSNRKVWRSQLQERMESAGVDPHRLHFLSDVDQKQEIML
MRAADAVVASLHMTRPRASLQAFAAGVPVVTFPSELWASRITYGFYQQMGVNDLVAASLD
EYVALTVKLATDMAFHKKMEQLITRNRSKLSEDVQAVQEWEKFFDFAGRQIFPSGEQKPG
SNWDWGQTDGLEGIDYWGQIEGVENVVEWSQIEKSDGVIDRKLVEKE

Enzyme Prediction     

No EC number prediction in KAG6613587.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT41	313	882	2.1e-66	0.5319148936170213

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226428	Spy	6.49e-31	511	884	245	611	Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones].
276809	TPR	1.55e-20	188	284	1	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
276809	TPR	5.00e-16	158	250	5	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
411346	social_mot_Tgl	7.44e-14	194	282	37	126	social motility TPR repeat lipoprotein Tgl. Social motility in delta-proteobacterial species such as Myxococcus xanthus depends on a type VI pilus, which in turn depends on assembly of the PilQ secretin complex. Tgl, a tetratricopeptide repeat (TPR) outer membrane lipoprotein, is required for PilQ assembly.
276809	TPR	2.32e-12	225	363	4	94	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ20641.1|GT41	0.0	18	914	21	933
BAZ61948.1|GT41	9.34e-61	332	887	365	884
BAZ15802.1|GT41	9.34e-61	332	887	365	884
BBO73735.1|GT41	3.27e-58	397	887	360	814
BBO66743.1|GT41	4.93e-56	413	885	458	899

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DJS_A	4.18e-16	486	865	121	491	Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_B Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_C Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_D Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum]
5NPS_A	1.04e-07	684	884	493	697	The human O-GlcNAc transferase in complex with a bisubstrate inhibitor [Homo sapiens]
5NPR_A	1.04e-07	684	884	492	696	The human O-GlcNAc transferase in complex with a thiol-linked bisubstrate inhibitor [Homo sapiens]
5HGV_A	1.04e-07	684	884	494	698	Structure of an O-GlcNAc transferase point mutant, D554N in complex with peptide [Homo sapiens],5HGV_C Structure of an O-GlcNAc transferase point mutant, D554N in complex with peptide [Homo sapiens]
6IBO_A	1.04e-07	684	884	498	702	Catalytic deficiency of O-GlcNAc transferase leads to X-linked intellectual disability [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P56558|OGT1_RAT	2.70e-07	684	884	806	1010	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Rattus norvegicus OX=10116 GN=Ogt PE=1 SV=1
sp|Q8CGY8|OGT1_MOUSE	2.71e-07	684	884	816	1020	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus OX=10090 GN=Ogt PE=1 SV=2
sp|Q9M8Y0|SEC_ARATH	6.00e-07	525	850	588	912	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana OX=3702 GN=SEC PE=1 SV=1
sp|O15294|OGT1_HUMAN	6.12e-07	684	884	816	1020	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens OX=9606 GN=OGT PE=1 SV=3
sp|P81436|OGT1_RABIT	6.12e-07	684	884	816	1020	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus OX=9986 GN=OGT PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000232	0.999751	CS pos: 18-19. Pr: 0.9557

TMHMM  Annotations     

Start	End
5	27