CAZyme Information: KAG6612434.1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: KAG6612434.1
• CAZy Family: GH5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
226		23987.17	4.4515

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiGKB4	19981	N/A	0	19981

• Gene Location: location=JAFJYM010000040:1174106-1174942(+)

Full Sequence      

MLDSDTSLYGEDCGYSDPNAKPKNPPTDGTATFERGLAHPGPCEIWLDDKMVLHNDDCAQ
AFSTKNYMSIKSKFKPVDYSSCSSSGCMFRFYWLAFQLGPNSKSKYSWQIYKNCIPLTGP
AAGQTSTFASNTTQSADESSAGSSTTETPAANPPASGDQTPQAPTSTDAPEKQASKSAAD
TPAPETQASEDTLAPETQASESAADTPAPITPTTTENCKAPQRKRA

Enzyme Prediction     

EC	1.14.99.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA17	3	186	2e-43	0.689795918367347

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
237030	kgd	2.58e-06	96	201	18	114	multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit.
183854	PRK13042	1.50e-05	125	203	17	95	superantigen-like protein SSL4; Reviewed.
215130	PLN02217	1.50e-04	120	197	566	652	probable pectinesterase/pectinesterase inhibitor
237030	kgd	8.09e-04	132	204	40	112	multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit.
273167	rad23	0.001	117	200	74	148	UV excision repair protein Rad23. All proteins in this family for which functions are known are components of a multiprotein complex used for targeting nucleotide excision repair to specific parts of the genome. In humans, Rad23 complexes with the XPC protein. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ETL32408.1|AA17	1.07e-58	1	141	51	195
EGZ23522.1|AA17	2.03e-57	1	148	82	218
ETL85648.1|AA17	4.41e-56	5	141	59	199
ETM38805.1|AA17	7.89e-56	1	126	82	203
ETI38761.1|AA17	7.89e-56	1	126	82	203

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Z5Y_A	1.40e-48	8	119	65	172	Chain A, Lytic Polysaccharide Monooxygenase [Phytophthora infestans T30-4],6Z5Y_B Chain B, Lytic Polysaccharide Monooxygenase [Phytophthora infestans T30-4]

Swiss-Prot Hits     

KAG6612434.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000063	0.000001

TMHMM  Annotations     

There is no transmembrane helices in KAG6612434.1.