CAZyme Information: KAG6612222.1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: KAG6612222.1
• CAZy Family: GH5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
629	JAFJYM010000041|CGC3	71046.11	7.7740

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiGKB4	19981	N/A	0	19981

• Gene Location: location=JAFJYM010000041:641575-643464(+)

Full Sequence      

MVARFLRRHLVLAAFVCVASIISAIVYEVTGGGKPKAWSYDAPELDAVDLEGPDRPRSLW
TDDDFECLGWRATHDCDPYGPRDEARDRPCDEPMPRSSGYCEVRNRTSGQVLRVMLATCK
SWQWYLVPKLSCSDARNFTDFSILAAGYTHPPPELPPPLPAKNSGEQGDKRGIVMIAYPK
VVAGVYAIVRTLRSLGCALPVEVWIDPTEMRAKHSVLVELVKYYNVLVRVVRDPNASKFH
AKPYAIYNSRFESVLWLDSDNIPVRDPTYLFDAPEFVKFGAMFWPDFWRPAIDTPFNVHQ
QSALWTLLDMPFTDMFEQESGQLLVNRSRSKAALSKLMFYSSHMPRLITDWQLVWGDKDL
FRLAWLNTSTPFYMVQHLVALGGLYDADEDFFCGVSMIQRDHVGDIIFMHRNQVKLTGRR
DQKPLITHLQKFTGGDGTAASLTRDLDKYRVQCKMRRLGQYTCFMLNPRTPDGNGTPSLI
VSLENTKYLQLEQHAIGFSIEGRGLFNKDEEAEVAKMEAVVQATQDEETAAIIAARERSE
KQTRGIFGIVVVGALGLWLRWQWIRRCRKSKPKLETKNSSVASAETSPSHVALAVDPSSP
EASGSSSAVFSGTTFNSRRRNSSFQIDDK

Enzyme Prediction     

No EC number prediction in KAG6612222.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	171	401	4e-49	0.9924242424242424

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	4.49e-29	170	401	1	273	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
132997	Glyco_tranf_GTA_type	0.001	188	266	12	93	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
133045	CESA_like	0.005	188	266	12	94	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ27901.1|GT71	0.0	2	556	7	559
CCA25306.1|GT71	2.80e-174	33	518	35	548
CCA20955.1|GT71	1.01e-121	53	508	86	554
UIZ28362.1|GT71	8.66e-113	53	509	654	1108
UIZ24000.1|GT71	4.18e-94	65	432	104	506

PDB Hits     

KAG6612222.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38069|MNN2_YEAST	8.96e-20	172	405	172	444	Alpha-1,2-mannosyltransferase MNN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN2 PE=1 SV=1
sp|Q59KJ7|MNN21_CANAL	2.67e-16	170	423	245	550	Alpha-1,2-mannosyltransferase MNN21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN21 PE=3 SV=1
sp|Q5AP90|MNN23_CANAL	7.40e-16	154	436	159	489	Alpha-1,2-mannosyltransferase MNN23 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN23 PE=3 SV=2
sp|Q5A687|MNN22_CANAL	3.34e-13	192	413	184	449	Alpha-1,2-mannosyltransferase MNN22 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN22 PE=2 SV=1
sp|P46982|MNN5_YEAST	4.40e-13	172	416	151	448	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN5 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.996732	0.003290

TMHMM  Annotations     

Start	End
5	27
545	564