CAZyme Information: KAG6611965.1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: KAG6611965.1
• CAZy Family: GH43
• CAZyme Description: Oxygen-dependent choline dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
455	JAFJYM010000042|CGC1	48229.09	4.4513

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiGKB4	19981	N/A	0	19981

• Gene Location: location=JAFJYM010000042:363986-372703(+)

Full Sequence      

MFAGIAFTSAIALASLVSQADAHGYLEQPKPSWSDSPNPGWVALVDNYWDIGSGGDQCGA
FKTMASQKGMSVKDVVLDMVKGKKCGNTLDSGAAQPIPSDGKVKWLGNGGGGFTHVGPCE
VYLDDKMVAHGDNCEDEYKGGGVGSTETSDIPVDYSACNGKCTLTIYWLAFQNAQWQAYA
HGHLKQPEPTFEDGASTVEWVTLIDNYWDIGSGGDQVGKFKTMAKEKGMSVRDVVLDMVK
DKKCGYTRTDVDPKPVPTDGKATWWGNGGGGFTHTGPCEIYIDDKMVLHGDDCEEEYPGG
PNGSNKLSEMPVDYSSCNGECTLAIYWLGFQNAQWQAYVNCVPLKGSGGSTTQQNRSSTT
DSSTGGQTTETPSSGTQSASGSSTQEQSKETPAATPQTVESPSTETQTTDAPSAEAPETE
APSANTPTTEVPSTETTDSKCKAPGRRLRKKVAAV

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA17	180	418	6.1e-64	0.9306122448979591
AA17	11	179	5.2e-55	0.6775510204081633

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
411474	fibronec_FbpA	3.18e-06	352	444	153	255	LPXTG-anchored fibronectin-binding protein FbpA. FbpA, a fibronectin-binding protein described in Streptococcus pyogenes, has a YSIRK-type (crosswall-targeting) signal peptide and a C-terminal LPXTG motif for covalent attachment to the cell wall. It is unrelated to the PavA-like protein from Streptococcus gordonii (see BlastRule NBR009716) that was given the identical name, so the phase LPXTG-anchored is added to the protein name for clarity.
411474	fibronec_FbpA	8.76e-06	350	444	119	220	LPXTG-anchored fibronectin-binding protein FbpA. FbpA, a fibronectin-binding protein described in Streptococcus pyogenes, has a YSIRK-type (crosswall-targeting) signal peptide and a C-terminal LPXTG motif for covalent attachment to the cell wall. It is unrelated to the PavA-like protein from Streptococcus gordonii (see BlastRule NBR009716) that was given the identical name, so the phase LPXTG-anchored is added to the protein name for clarity.
215130	PLN02217	9.14e-06	344	439	562	664	probable pectinesterase/pectinesterase inhibitor
139494	PRK13335	5.12e-05	352	444	68	155	superantigen-like protein SSL3; Reviewed.
183854	PRK13042	1.01e-04	350	420	22	98	superantigen-like protein SSL4; Reviewed.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ETO83080.1|AA17	2.97e-113	178	372	19	211
ETN14460.1|AA17	2.97e-113	178	372	19	211
ETN14458.1|AA17	2.97e-113	178	372	19	211
ETO83083.1|AA17	3.65e-113	178	372	25	217
ETI54333.1|AA17	3.65e-113	178	372	25	217

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Z5Y_A	2.48e-29	181	346	1	172	Chain A, Lytic Polysaccharide Monooxygenase [Phytophthora infestans T30-4],6Z5Y_B Chain B, Lytic Polysaccharide Monooxygenase [Phytophthora infestans T30-4]

Swiss-Prot Hits     

KAG6611965.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000228	0.999746	CS pos: 22-23. Pr: 0.9715

TMHMM  Annotations     

There is no transmembrane helices in KAG6611965.1.