CAZyme Information: KAG6611931.1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: KAG6611931.1
• CAZy Family: GH38
• CAZyme Description: Pectin methylesterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
349	JAFJYM010000043|CGC3	37822.53	8.5328

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiGKB4	19981	N/A	0	19981

• Gene Location: location=JAFJYM010000043:149819-150941(-)

Full Sequence      

MQFFAPLVLLATLASGALAGAGGGVKCSGLNARVRPPKGAIVVDATGAHPGSYKTVSEGV
ANIPNTTAEHTLFVFPGVYQEQVVVPRFNGPIVLQGYTCNTQSYAHNQVTITHSMAQKDL
PANTTGSLNQLVSTMLFRSKNGTRVYNLNVANPEPKIKNLGQAIAVYVDGPKHGFYACNM
TGYQDTLCANKGPQLYAKSYINGAVDFIFGLLSKSWFESCDIESIGNGSITANGNGNSSN
LSEYVINNARVFGHYNKSAAYLGRPWFPYARVVFQNSELGDVINPQGWQKWNKDNNTGNV
YFKEFNNRGPGAATDERVSFSGQLDAAVPITDILGDDYKSQWYVDKKFL

Enzyme Prediction     

EC	3.1.1.11:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	42	326	9.1e-70	0.9409722222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178051	PLN02432	7.63e-44	41	331	13	282	putative pectinesterase
178113	PLN02497	3.52e-43	41	327	34	309	probable pectinesterase
395871	Pectinesterase	5.36e-43	44	322	1	276	Pectinesterase.
178372	PLN02773	8.78e-43	48	324	10	282	pectinesterase
215357	PLN02665	1.06e-41	51	325	78	341	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACO54875.1|CE8	4.26e-178	1	349	1	346
ACO54873.1|CE8	1.48e-159	1	349	1	344
ACO54874.1|CE8	4.70e-159	6	349	7	348
ABQ63096.1|CE8	2.43e-158	1	349	1	344
ACO54869.1|CE8	7.70e-158	1	349	1	338

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	3.77e-51	33	348	3	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	5.30e-51	33	348	3	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	1.17e-28	41	322	9	283	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	8.00e-28	51	322	13	279	Chain A, Pectinesterase 1 [Solanum lycopersicum]
4PMH_A	3.72e-08	53	312	48	366	The structure of rice weevil pectin methyl esterase [Sitophilus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12535|PME_ASPAC	2.22e-71	33	348	20	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|P17872|PME_ASPNG	8.58e-65	33	349	20	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q4WBT5|PMEA_ASPFU	5.64e-57	33	340	28	318	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	5.64e-57	33	340	28	318	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1
sp|A1DBT4|PMEA_NEOFI	2.67e-54	33	340	28	318	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000192	0.999769	CS pos: 19-20. Pr: 0.9810

TMHMM  Annotations     

There is no transmembrane helices in KAG6611931.1.