CAZyme Information: KAG6611913.1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: KAG6611913.1
• CAZy Family: GH32
• CAZyme Description: Pectin methylesterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
346		37826.22	5.7607

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiGKB4	19981	N/A	0	19981

• Gene Location: location=JAFJYM010000043:200859-201899(+)

Full Sequence      

MHTCSLPLVVLASLASGTLANLCKGPNARTEPPTGAIIVDATGAYHGSFRTVTEGVANIP
NTTDEHTLFVFPGVYREQVFINPLNGPLVLQGYTCDTMSYAANQVTITQAKAQRDISPDY
IGDPNYPTSTLGLPASNVKMYNLNVANTAGKIGGKVGQAVAAYVGNGTDYGFYGCKFSSY
QDTLCAMNGRQLYARSYIGGAVDFIFGKQAQAWFEDCDIESVGQGYVTANGRYNESNPSW
YVFNRARVFGPSGVNSTYLGRPWRTYSRVVFENSDLSDIVRPEGWKAWNNDTDTTNIFYK
EFNNTGPGAATDKRVAFSGTLDKPVLITDIFGDNYKSNWWVDTKFL

Enzyme Prediction     

EC	3.1.1.11:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	46	319	5e-74	0.90625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178113	PLN02497	3.64e-48	37	321	34	306	probable pectinesterase
395871	Pectinesterase	8.60e-48	40	319	1	276	Pectinesterase.
178051	PLN02432	9.60e-48	37	334	13	289	putative pectinesterase
177947	PLN02313	2.00e-42	37	319	273	551	Pectinesterase/pectinesterase inhibitor
215367	PLN02682	2.36e-42	33	321	67	347	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACO54873.1|CE8	4.23e-170	1	346	1	344
ABQ63096.1|CE8	1.72e-169	1	346	1	344
ACO54871.1|CE8	4.11e-157	1	345	1	343
ACO54874.1|CE8	1.52e-154	1	346	1	348
ACO54870.1|CE8	1.97e-152	1	346	1	347

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	4.65e-62	29	345	3	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	6.56e-62	29	345	3	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	2.73e-36	37	319	9	283	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	7.31e-35	37	319	1	279	Chain A, Pectinesterase 1 [Solanum lycopersicum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P17872|PME_ASPNG	1.60e-70	29	346	20	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q12535|PME_ASPAC	2.27e-70	29	345	20	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|B0Y9F9|PMEA_ASPFC	2.31e-68	6	345	3	324	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1
sp|Q4WBT5|PMEA_ASPFU	2.31e-68	6	345	3	324	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|A1DBT4|PMEA_NEOFI	2.58e-67	6	345	3	324	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000254	0.999730	CS pos: 20-21. Pr: 0.9753

TMHMM  Annotations     

There is no transmembrane helices in KAG6611913.1.