CAZyme Information: KAG6611835.1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: KAG6611835.1
• CAZy Family: GH32
• CAZyme Description: ER degradation-enhancing alpha-mannosidase-like protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1197	JAFJYM010000043|CGC4	133118.09	5.8766

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiGKB4	19981	N/A	0	19981

• Gene Location: location=JAFJYM010000043:628993-632666(-)

Full Sequence      

MLPRQHQARHGDGRGAAYRASRYAWGATVKRACTCAFLLSFALLFVSVGAAPSENGAKSD
GESQPPVLSHFNGLHTLSGASYRAFKNRLKRQMRGESCLRYHVAGTWWHYEWCVDKHVRQ
FHPQPAGPKAQKPKELSILLGAYNAEKPQPLRVLAVDNLARLADPDRMGYMAQQLYGSGD
YCEERGAPRMVKLQVKCCAFHDNETYVDSVEEKAPCEYEMNVCSPVACGLMQRDQFVLTA
PTYMEVEERKALAKTVRGMFYHAYNGYLKHAFPQDDLLPLSCRGGEFELGRLPMLTLVDT
LDTLAVLEDATEFRRAVELVVENADFNLDTEVSVFETTIRLLGGLLSAHLFAVNTDLKLY
PDGDYDGALLRLAVDLGDRLMPAFDTVTGIPYGTVNLKHGVPKGETPIASTAGAGSLSIE
FTMLSVLTGDPKYAAASRGAVRALFQRRSKIGLLGKHINTKNGDWTETSSGPGSNSDSFY
EYLLKMYELFGDREALEMFAQVYPAVLAHNKHGDWYTDVSMYTGCHHHSGSSSVVFESLA
AFWPGMQIAAGDLNDAAKSMNAFYRVWRDYGFLSEQFNVGDWKPVKSRGGGGARYPLRPE
LIESTFYMHEATNDSSWLRAGAHVVHSLQKYAKTPCGYASIADVDSKKQEDYMPSFFLSE
TCKYLYLLFNTTHFFRQGNYVMTTEAHPLPILPTKLVEPILQAADAYVTKSEVSYDNRYS
PERVMRCEAPKFYDLIDYSVHYEGKVVARTTRCSPAAPSPAALIKASKPAAEKIAQSASE
KAKPTKPTTTTTTTTKKKAKPIDTESVASDVLQEWLPALEEKLRKIGGKNVNDEWLQHLL
EDTSLSVTKKRQPVMQQDDQGHVVQHLYGGSQLGEFRVEQLPGRLRVTREETGDWIEASG
IVDASHMIVGLGFNDGSDDDDIGADSYTFEEPTSKKVDHGDDYHPPYMAWSYVYKVNEDL
SLPVDQRCSLRVQVGYKPHPGEPQHNGKGTRTFKASRAFPNMELVVADPVDACSEVSNLP
EERLRGKIVLAQRGECFFETKARNAEKWGAAGVIIVNTEDDDLVMVMGGVDENSAEATDE
PLDIPVVMVPERLGEWFETRLVEAEASSLAPVVVSIELTVRHHDREVDQTRRRGRGISGD
RSFPRIDGTADNMKVYGPVWGVELITMGSDSENGQDQEDDHQESFTIAIVGTPPWQH

Enzyme Prediction     

EC	3.2.1.113:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	259	691	7e-136	0.9977578475336323

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	7.28e-142	259	691	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	1.85e-85	253	694	73	521	glycoside hydrolase family 47 protein; Provisional
239038	PA_C_RZF_like	3.65e-20	1004	1095	44	131	PA_C-RZF_ like: Protease-associated (PA) domain C_RZF-like. This group includes various PA domain-containing proteins similar to C-RZF (chicken embryo RING zinc finger) protein. These proteins contain a C3H2C3 RING finger. C-RZF is expressed in embryo cells and is restricted mainly to brain and heart, it is localized to both the nucleus and endosomes. Additional C3H2C3 RING finger proteins belonging to this group, include Arabidopsis ReMembR-H2 protein and mouse sperizin. ReMembR-H2 is likely to be an integral membrane protein, and to traffic through the endosomal pathway. Sperizin is expressed in haploid germ cells and localized in the cytoplasm, it may participate in spermatogenesis. The significance of the PA domain to these proteins has not been ascertained. It may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate.
240122	PA_subtilisin_1	2.17e-18	989	1090	6	97	PA_subtilisin_1: Protease-associated domain containing subtilisin-like proteases, subgroup 1. A subgroup of PA domain-containing subtilisin-like proteases. The significance of the PA domain to many of the proteins in which it is inserted is undetermined. It may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate. Proteins into which the PA domain is inserted include the following subtilisin-like proteases: i) melon cucumisin, ii) Arabidopsis thaliana Ara12, iii) Alnus glutinosa ag12, iv) members of the tomato P69 family, and v) tomato LeSBT2. However, these proteins belong to other subtilisin-like subgroups. Relatively little is known about proteins in this subgroup.
239047	PA_GO-like	4.26e-17	1004	1095	42	123	PA_GO-like: Protease-associated domain containing proteins like Arabidopsis thaliana growth-on protein GRO10. This group contains various PA domain-containing proteins similar to the functionally uncharacterized Arabidopsis GRO10. The PA domain may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ27914.1|GH47	0.0	171	1194	1	1042
AIG56334.1|GH47	3.31e-245	89	1164	39	929
AIG55397.1|GH47	3.99e-233	98	1171	33	933
QCE07576.1|GH47	3.31e-129	247	693	30	470
BAT94804.1|GH47	4.48e-129	247	693	30	470

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KKB_A	8.32e-54	241	692	14	468	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]
1NXC_A	1.02e-53	241	692	12	466	Structure of mouse Golgi alpha-1,2-mannosidase IA reveals the molecular basis for substrate specificity among Class I enzymes (family 47 glycosidases) [Mus musculus]
4AYO_A	1.69e-53	247	689	8	433	Structure of The GH47 processing alpha-1,2-mannosidase from Caulobacter strain K31 [Caulobacter sp. K31],4AYP_A Structure of The GH47 processing alpha-1,2-mannosidase from Caulobacter strain K31 in complex with thiomannobioside [Caulobacter sp. K31],4AYQ_A Structure of The GH47 processing alpha-1,2-mannosidase from Caulobacter strain K31 in complex with mannoimidazole [Caulobacter sp. K31],4AYR_A Structure of The GH47 processing alpha-1,2-mannosidase from Caulobacter strain K31 in complex with noeuromycin [Caulobacter sp. K31],5MEH_A Crystal structure of alpha-1,2-mannosidase from Caulobacter K31 strain in complex with 1-deoxymannojirimycin [Caulobacter sp. K31],5NE5_A Crystal structure of family 47 alpha-1,2-mannosidase from Caulobacter K31 strain in complex with kifunensine [Caulobacter sp. K31]
5KIJ_A	8.68e-53	254	691	7	451	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
1FMI_A	9.96e-53	254	691	12	456	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9FG93|MNS4_ARATH	1.66e-127	247	693	35	475	Alpha-mannosidase I MNS4 OS=Arabidopsis thaliana OX=3702 GN=MNS4 PE=1 SV=1
sp|Q8BJT9|EDEM2_MOUSE	1.08e-115	239	689	28	480	ER degradation-enhancing alpha-mannosidase-like protein 2 OS=Mus musculus OX=10090 GN=Edem2 PE=1 SV=1
sp|Q9BV94|EDEM2_HUMAN	2.16e-115	256	689	39	480	ER degradation-enhancing alpha-mannosidase-like protein 2 OS=Homo sapiens OX=9606 GN=EDEM2 PE=1 SV=2
sp|Q9SXC9|MNS5_ARATH	7.23e-115	236	692	20	479	Alpha-mannosidase I MNS5 OS=Arabidopsis thaliana OX=3702 GN=MNS5 PE=1 SV=1
sp|Q925U4|EDEM1_MOUSE	4.58e-103	249	691	122	581	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Mus musculus OX=10090 GN=Edem1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.606860	0.393130

TMHMM  Annotations     

There is no transmembrane helices in KAG6611835.1.