CAZyme Information: KAG6611156.1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: KAG6611156.1
• CAZy Family: GH30
• CAZyme Description: Pectate lyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365		38632.01	7.6528

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiGKB4	19981	N/A	0	19981

• Gene Location: location=JAFJYM010000048:257494-258696(-)

Full Sequence      

MKFLRPVLVAVVALVSQTSEAFTIGSATGLAAGTTGGGSATAVYPTTTAQLVAYLKDSVP
RVIVLNKTFDFRGTEGTTTEAGCRPDYTRECIAKNNGYKSQDVILQSGGMSNTGGCSDGT
SVTVTYNNAAITPMTVTSNKTLRGIGTTGVIMGKGLWLNGDNIIIQNVHITELNRHLFLT
TNAASVSTMTISNSDFDGRTDYSATCDGRHYWTFIFYGENTRFSMLNNYIHSTSGRSPKL
GGDSSANVVAHIANNYWADNSGHSFEVGVNAWILAEGNYFEDTTLPLLTGSDGYMYAATA
TTECSSYLGRSCAANVVDNSGAFGSRNGATALSKVKSYSAISGYSPRAAKQWSKTTSNFG
IGVLN

Enzyme Prediction     

EC	4.2.2.10:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	178	282	9.1e-41	0.5454545454545454

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	2.63e-18	124	283	2	189	Amb_all domain.
226384	PelB	9.94e-08	97	287	51	280	Pectate lyase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHX74068.1|PL1_4	2.42e-236	1	365	1	400
ADN18834.1|PL1_4	2.58e-231	1	365	1	400
ADN18833.1|PL1_4	9.12e-183	1	365	1	400
ACR19248.1|PL1_4	1.66e-166	43	365	134	491
AHX74066.1|PL1_4	7.96e-143	10	364	10	409

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QCX_A	1.74e-67	24	362	4	358	Pectin Lyase B [Aspergillus niger]
1IDK_A	4.23e-65	25	323	5	321	Pectin Lyase A [Aspergillus niger]
1IDJ_A	1.02e-62	25	323	5	321	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BA61|PELB_EMENI	1.68e-72	1	323	1	341	Pectin lyase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pelB PE=2 SV=1
sp|Q2TXS4|PELD_ASPOR	2.11e-72	7	321	6	338	Pectin lyase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pel2 PE=1 SV=1
sp|B8NVB7|PELD_ASPFN	2.11e-72	7	321	6	338	Probable pectin lyase D OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelD PE=3 SV=1
sp|A1CYC2|PELA_NEOFI	3.25e-72	8	323	6	340	Probable pectin lyase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pelA PE=3 SV=2
sp|Q2TXM4|PELA_ASPOR	3.34e-72	25	323	24	341	Probable pectin lyase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000206	0.999763	CS pos: 21-22. Pr: 0.9779

TMHMM  Annotations     

There is no transmembrane helices in KAG6611156.1.