CAZyme Information: KAG6610858.1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: KAG6610858.1
• CAZy Family: GH30
• CAZyme Description: Multicopper oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
548		60486.14	4.5013

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiGKB4	19981	N/A	0	19981

• Gene Location: location=JAFJYM010000050:1056352-1063526(+)

Full Sequence      

MGRSQLSVVLASFLALHFSLLCGRGACDVVTYDWRLTPIMTAFDGVLLETLGVNDKPSHE
AVIEVELGQEVEVRVTNELYNATCLHWHGMKQLGTQEMDGVSGFTQCFIEPNATAVYRFK
PDKAGTFWWHSHHKTQYAFGLRGPLIVHAPTSDLRACEKEIEQEFTVQLADIYHTAPKFG
PALWDTIVINNRGRFNCTDAAINNLTECSNDQPLTTYDFQAGKKYLLRLINVAAMAPFDF
SIDDHEFRVIAADGEPVEPTEPINSIFINAGQRYDIVLESKNDTQDSFWMRAKGLTGLPW
MARSADTGLPGFNDEGLAIVRYDAASTSEPMTTQCEETVTVNEFDFKPVVPSVLPTTPSD
RSIVQFNITQLGGVISLDGGKYNSLAIPDQPPLLTISNGSTTSDLPATANARALEYGKHI
EVVVVNSMNEQHPFHLHSHAPWVVGSGQASAEDVYNNDLPPSKLEGAVLRDVYTVPPCNT
DEDGYCVNVGYLILRFTADNPGVWMMHCHIDWHMDIGLAMIFVEGEAELQEKGPDSFSSS
LLSVCKGD

Enzyme Prediction     

No EC number prediction in KAG6610858.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA1	61	519	3.6e-92	0.9413407821229051

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
274555	ascorbase	1.32e-66	29	525	1	524	L-ascorbate oxidase, plant type. Members of this protein family are the copper-containing enzyme L-ascorbate oxidase (EC 1.10.3.3), also called ascorbase. This family is found in flowering plants, and shows greater sequence similarity to a family of laccases (EC 1.10.3.2) from plants than to other known ascorbate oxidases.
225043	SufI	6.95e-61	62	527	65	451	Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) [Cell cycle control, cell division, chromosome partitioning, Inorganic ion transport and metabolism, Cell wall/membrane/envelope biogenesis].
177843	PLN02191	9.78e-59	44	525	41	547	L-ascorbate oxidase
215324	PLN02604	2.56e-53	63	525	57	547	oxidoreductase
274556	laccase	1.40e-43	63	523	36	518	laccase, plant. Members of this protein family include the copper-containing enzyme laccase (EC 1.10.3.2), often several from a single plant species, and additional, uncharacterized, closely related plant proteins termed laccase-like multicopper oxidases. This protein family shows considerable sequence similarity to the L-ascorbate oxidase (EC 1.10.3.3) family. Laccases are enzymes of rather broad specificity, and classification of all proteins scoring about the trusted cutoff of this model as laccases may be appropriate.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFY09916.1|AA1	3.40e-243	1	545	1	544
UIZ26488.1|AA1	1.06e-230	26	545	13	536
AFY09915.1|AA1	2.41e-194	29	548	21	568
UIZ26495.1|AA1	1.82e-193	29	547	23	563
AIG56347.1|AA1_2	3.71e-82	6	547	17	556

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z1X_A	5.30e-72	62	534	35	475	Crystal Structure of Laccase from Cerrena sp. RSD1 [Cerrena],5Z1X_B Crystal Structure of Laccase from Cerrena sp. RSD1 [Cerrena],5Z22_A Crystal Structure of Laccase from Cerrena sp. RSD1 [Cerrena]
1HFU_A	1.96e-69	59	527	32	471	Chain A, LACCASE 1 [Coprinopsis cinerea]
1A65_A	2.00e-69	59	527	32	471	Chain A, Laccase [Coprinopsis cinerea]
1KYA_A	7.12e-68	33	534	7	479	Chain A, Laccase [Trametes versicolor],1KYA_B Chain B, Laccase [Trametes versicolor],1KYA_C Chain C, Laccase [Trametes versicolor],1KYA_D Chain D, Laccase [Trametes versicolor]
3FPX_A	9.95e-68	33	534	7	479	Native fungus laccase from Trametes hirsuta [Trametes hirsuta],3V9C_A Type-2 Cu-depleted fungus laccase from Trametes hirsuta at low dose of ionization radiation [Trametes hirsuta]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12717|LAC5_TRAVE	2.59e-67	68	534	64	507	Laccase-5 OS=Trametes versicolor OX=5325 GN=LCC5 PE=2 SV=1
sp|O59896|LAC1_PYCCI	5.73e-67	3	534	5	498	Laccase OS=Pycnoporus cinnabarinus OX=5643 GN=LCC3-1 PE=1 SV=1
sp|Q99056|LAC5_TRAVI	7.05e-67	68	534	64	507	Laccase-5 OS=Trametes villosa OX=47662 GN=LCC5 PE=3 SV=2
sp|Q99044|LAC1_TRAVI	1.17e-66	33	534	28	500	Laccase-1 OS=Trametes villosa OX=47662 GN=LCC1 PE=1 SV=1
sp|Q01679|LAC1_PHLRA	1.22e-65	68	534	62	500	Laccase OS=Phlebia radiata OX=5308 GN=LAC PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000551	0.999443	CS pos: 25-26. Pr: 0.7739

TMHMM  Annotations     

There is no transmembrane helices in KAG6610858.1.