CAZyme Information: KAG6610229.1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: KAG6610229.1
• CAZy Family: GH3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
757	JAFJYM010000054|CGC4	82185.72	4.1810

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiGKB4	19981	N/A	0	19981

• Gene Location: location=JAFJYM010000054:2429620-2431964(+)

Full Sequence      

MVAATATAALADFTTLQAGSNYQQGTVQPAEQVKGGTTSTSGSTTVGTTSTTGSSASSGD
YLSPFSTDAPSNLFQRYDTLTTLAPIINVASDLLTRPLPTNKWWGNLIHTTTADIDTVAN
PAWSNPYALKLPKEAPYGVQACYSYSYRSFADEVDGVVKYYLHAFHNDLTLSATEFASTK
PDYEIYSFSDFGASVRTCVSGSDSCMDSALVNGMAFVSATYSGLTASIESEYAMTMVDDS
TAGKYVIQLPSNQTWVIYSSDTSASFSIDSTGSALVSSAAYTGTLRVAILPDSGDQTVYD
DYSSCVIRSGNVSVASRTSYSLQWETEGSGCDSTGLLHFALPHQVEAMSEATTTQSSGAI
VLHSSTRGQMVGQVTTSGSWTLTEDEADDEVDFYPANKPSSDVVSQIGLLATLQSDIDSD
WSLDTGSWYYNGKAYQKYASLCLMAADSSVVGDDTTLLSTCLSRLEGLVEPFLNNTLGSP
LAYETSYKGIVTSQVFTANDADVEFGNGVYNDHHYHYGYWVTASAILKKLDPSWSGMAQL
ETMVWTLLRDVANPSSDDTYFPKFRHFSWYLGHSYSHGVTPMADGKDEESTSEDVNFYYG
MMLWGKVTQNQAVEDLGSLMLRLNARAVRTYFLMTSDNTIHPPQFVPNHVTGIFFDNKAD
YATWFSADKYCIHGIQMIPVSPINGLVRTKTFIQEEWDDILSKEAIVTGDDTTNAWLSLL
LVNEAVIDQADALSKLATATMDDGLTRSDAKRYNSDT

Enzyme Prediction     

No EC number prediction in KAG6610229.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	89	748	1.5e-175	0.9742765273311897

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	3.88e-142	413	748	18	346	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	4.71e-134	65	745	61	738	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	1.22e-53	95	395	12	318	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26438.1|GH81	0.0	4	748	9	731
UIZ26440.1|GH81	0.0	4	748	9	731
UIZ26131.1|GH81	1.40e-298	61	757	12	713
UIZ26137.1|GH81	2.05e-293	61	757	122	823
UIZ26602.1|GH81	2.05e-293	61	757	122	823

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	1.89e-90	98	748	41	709	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	3.16e-90	98	748	66	734	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	1.41e-85	98	748	41	709	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	3.04e-26	511	732	414	630	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	8.23e-23	91	745	42	667	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	3.16e-100	84	740	23	680	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	1.80e-86	60	742	192	882	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	2.62e-83	58	743	425	1122	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1
sp|P53753|ENG1_YEAST	2.49e-82	66	742	407	1091	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	5.95e-79	194	747	171	727	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.984445	0.015583

TMHMM  Annotations     

There is no transmembrane helices in KAG6610229.1.