CAZyme Information: KAG6609685.1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: KAG6609685.1
• CAZy Family: GH3
• CAZyme Description: GlcNac transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
558	JAFJYM010000054|CGC5	62010.17	6.5850

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiGKB4	19981	N/A	0	19981

• Gene Location: location=JAFJYM010000054:257130-258806(+)

Full Sequence      

MAASRPRMPLLLLALAALLLPSHVAAEGMNSVMGIINTKRSVKLDPSVQHIPLDPAQSNL
RPPPAQIPASFDVFVGLSVFRDGYRCGKTIFTGLKRAKYPERLFFGVVDQVNDGDDRCLD
EFCKMAEAEWPDKGPCPYKDHIRVDVHSASESRGPTLARHQQQKLIRQEEFCLQLDGHSI
FTNLWDENLLAEWKRINNEMAVISTYLHHIHDFVKENGDNALSASLPHLCSTMRGSNGLV
RTVGASMISGSKFPQLEALWGAGLSFNKCHAERRVPVDSHTLWMFDGEEFLRASRLWTSG
YDMYSPSVLGSVIYHNYSKVPARFEHITVDRQVKKRESEMAINRFNHIVGKPIKGLVDTY
ELDKYGLGSVRSFESYLKFSGVTFKEGVNDTESCEQLHWVPYENATEVEALVGNGWKLKE
KSAVVAEPTPKQQVAQEVEQDAEAQKATGTKEGTTQPPKERGVVDDDPNAEVARHAADAH
AENGADIGEDEQLEAAKARLRQEVVGNRAAKGPSTAPIWFFLFVVVAALFVTLSKDSVSR
SIRLTFCASAPHTHSSNE

Enzyme Prediction     

No EC number prediction in KAG6609685.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT60	72	385	1.3e-58	0.996969696969697

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
371506	GlcNAc	1.79e-39	72	384	1	349	Glycosyltransferase (GlcNAc). GlcNAc is an enzyme that carries out the first glycosylation step of hydroxylated Skp1, a ubiquitous eukaryotic protein, in the cytoplasm.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ22573.1|GT60	5.17e-262	2	558	3	503
QVE55543.1|GT60	1.40e-205	19	545	15	481
UIZ25301.1|GT60	8.07e-198	27	418	4	397
UIZ25379.1|GT60	8.97e-174	40	547	39	513
CCA18910.1|GT60	9.03e-37	77	402	91	412

PDB Hits     

KAG6609685.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8T1C6|GNT1_DICDI	6.66e-18	73	319	6	251	[Skp1-protein]-hydroxyproline N-acetylglucosaminyltransferase OS=Dictyostelium discoideum OX=44689 GN=gnt1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000212	0.999776	CS pos: 26-27. Pr: 0.9776

TMHMM  Annotations     

Start	End
516	533