CAZyme Information: KAG6609195.1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: KAG6609195.1
• CAZy Family: GH28
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
491		54982.42	8.1195

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiGKB4	19981	N/A	0	19981

• Gene Location: location=JAFJYM010000055:492172-494075(-)

Full Sequence      

MPVKAVVARFLRRHLVLAAFVCVASIISAIVYEVTGGGKPKAWSYDAPELDAVDLEGPDR
PRSLWTDDDFECLGWRATHDCDPYGPRDEARDRPCDEPMPRSSGYCEVRNRTSGQVLRVM
LATCKSWQWYLVPKLSCSDARNFTDFSILAAGYTHPPPELPPPLPAKNSGEQGDKRASSL
GCALPVEVWIDPTEMRAKHSVLVELVKYYNVLVRVVRDPNASKFHAKPYAIYNSRFESVL
WLDSDNIPVRDPTYLFDAPEFRDHVGDIIFMHRNQVKLTGRRDQKPLITHLQKFTGGDGT
AASLTRDLDKYRVQCKMRRLGQYTCFMLNPRTPDGNGTPSLIVSLENTKYLQLEQHAIGF
SIEGRGLFNKDEEAEVAKMEAVVQATQDEETAAIIAARERSEKQTRGIFGIVVVGALGLW
LRWQWIRRCRKSKPKLETKNSSVASAETSPSHVALAVDPSSPEASGSSSAVFSGTTFNSR
RRNSSFQIDDK

Enzyme Prediction     

No EC number prediction in KAG6609195.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	179	264	1.1e-17	0.3522727272727273

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	7.27e-11	180	274	26	130	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
132997	Glyco_tranf_GTA_type	5.12e-04	185	283	26	131	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ27901.1|GT71	1.66e-210	1	418	1	559
CCA25306.1|GT71	2.93e-73	38	380	35	548
CCA20955.1|GT71	2.19e-37	58	261	86	333
UIZ28362.1|GT71	5.90e-35	58	261	654	884
AIG56191.1|GT71	4.57e-33	55	264	30	251

PDB Hits     

KAG6609195.1 has no PDB hit.

Swiss-Prot Hits     

KAG6609195.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999998	0.000023

TMHMM  Annotations     

Start	End
13	35
407	426