CAZyme Information: KAG6608708.1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: KAG6608708.1
• CAZy Family: GH28
• CAZyme Description: Alpha-L-arabinofuranosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
294		30791.88	4.4107

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiGKB4	19981	N/A	0	19981

• Gene Location: location=JAFJYM010000057:385564-386448(+)

Full Sequence      

MYQVKRASDSTTLDIKPLKAGGIADAASQDTFCKDTTCVISIIYDQSGKGNHLTSAPAGG
AKNTPDDPSRADRLPVTIGREKAYGVYIEAGNGYRNNNTTGIPTGDDAEAIYIVVNGTHY
NQHCCFDYGNAETNNMNDGAATMEAIYFGNSKQWGYGEGTGPWVMADLEDGLFGCAAGKQ
CTNTPTVSATPYLVAMLKGRSGGTFAIKQGSAQSGPLQTTYDGPRPNGYTVMKKQGAIIL
GIGGDNSNWAVGSFYEGVIVSGDPTNDVDDKVQANIVAAAYGGESEEPVSESSP

Enzyme Prediction     

EC	3.2.1.55:24	3.2.1.37:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH54	1	282	1e-115	0.8987341772151899

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
401229	ArabFuran-catal	2.66e-154	1	282	30	315	Alpha-L-arabinofuranosidase B, catalytic. Members of this family, which are present in fungal alpha-L-arabinofuranosidase B, adopt a beta-sandwich fold similar to that of Concanavalin A-like lectins/glucanase. The beta-sandwich fold consists of two anti-parallel beta-sheets with seven and and six strands, respectively. In addition, there are four helices outside of the beta-strands. The beta-sandwich strands are closely packed and curved with a jelly roll topology, creating a small catalytic pocket. The domain catalyzes the hydrolysis of alpha-1,2-, alpha-1,3- and alpha-1,5-L-arabinofuranosidic bonds in L-arabinose-containing hemicelluloses such as arabinoxylan and L-arabinan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ21887.1|GH54	7.07e-135	1	282	49	328
AJF69432.1|CBM42|GH54	3.75e-113	1	281	70	350
AUY53522.1|CBM42|GH54	7.73e-113	1	281	71	351
AGL16124.1|CBM2|GH54	1.13e-112	1	281	192	472
UFR01329.1|CBM13|GH54	1.60e-112	1	285	113	397

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1WD3_A	1.04e-102	1	281	32	316	Crystal structure of arabinofuranosidase [Aspergillus luchuensis],1WD4_A Crystal structure of arabinofuranosidase complexed with arabinose [Aspergillus luchuensis],6SXS_AAA Chain AAA, Alpha-L-arabinofuranosidase B [Aspergillus luchuensis]
6SXT_A	1.08e-102	1	281	33	317	GH54 a-l-arabinofuranosidase soaked with aziridine inhibitor [Aspergillus luchuensis IFO 4308]
6SXR_A	2.95e-102	1	281	32	316	E221Q mutant of GH54 a-l-arabinofuranosidase soaked with 4-nitrophenyl a-l-arabinofuranoside [Aspergillus luchuensis IFO 4308]
2D43_A	8.36e-102	1	281	32	316	Chain A, alpha-L-arabinofuranosidase B [Aspergillus luchuensis],2D44_A Chain A, alpha-L-arabinofuranosidase B [Aspergillus luchuensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2R511|ABFB_ASPNC	1.10e-102	1	281	49	333	Probable alpha-L-arabinofuranosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=abfB PE=3 SV=1
sp|P42255|ABFB_ASPNG	1.10e-102	1	281	49	333	Alpha-L-arabinofuranosidase B OS=Aspergillus niger OX=5061 GN=abfB PE=1 SV=1
sp|B8N7I7|ABFB_ASPFN	5.38e-102	1	281	57	341	Probable alpha-L-arabinofuranosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=abfB PE=3 SV=1
sp|Q8NK89|ABFB_ASPKW	8.80e-102	1	281	49	333	Alpha-L-arabinofuranosidase B OS=Aspergillus kawachii (strain NBRC 4308) OX=1033177 GN=abfB PE=1 SV=1
sp|Q4WL66|ABFB_ASPFU	1.08e-101	1	281	57	341	Probable alpha-L-arabinofuranosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=abfB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999778	0.000270

TMHMM  Annotations     

There is no transmembrane helices in KAG6608708.1.