CAZyme Information: KAG6606618.1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: KAG6606618.1
• CAZy Family: GH28
• CAZyme Description: Choline dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
659	JAFJYM010000058|CGC2	73097.34	6.5063

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiGKB4	19981	N/A	0	19981

• Gene Location: location=JAFJYM010000058:490086-495431(-)

Full Sequence      

MDRGLLDSIRLAMPAMLPANLVDARYNWNYVTEPQRNLNGRRLTWPRGRVLGGSSSINAM
IYNRGHALDYEDWLESGAQGWGYADCLPYFKRAQTHALGRDDYRGGDGPLHVTRRLQRNQ
PLFQAFLDAAVQAGYPFTEDVNGYQQEGVGWLDLTIHNGSRCSASAAYLTESVLTRENLT
VLTDTFVNKLVFEGKRAVGIEMEPFKTNNGDQPPRRVQAAKEVILSGGAINSPQLLMLSG
VGDARHLKEVGVPLVHHLPAVGRNLEEHLGVYLHVTCTKPVTLYHATPHFPHKMAWMGIQ
WLTSKTGAGTSSHIEAGGFIRSAPGKRHPDLKWQFLPGASDEDRQLLRDGHAMMLHCTPL
RATSRGFIKLRSANPRESPIIQPNYLDTETDRVDIRNGVRLTREVLRQQAFDKFRGDAVS
PSDDVQSDAEIDAWGFIDGEWVEALGNEHFIVEDPATELEVARVTSMGAEDTHTAVTAAM
SAQREWKRSTPPGRAKLLREWAAAITANNYNMTENEESYKATVIGGNCTVMAKGETYNYA
QFHVHTPSEHTIDGQAFDGEIHFVHKKADGSAALVIGLFLRKTDAADTEPAVDIIVDAMS
DVTFNTSIPMTLGSYSELIGAYVEKGHVFNYAGSLTTPPCTEFVDCPVSMTERRRLVRR

Enzyme Prediction     

No EC number prediction in KAG6606618.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	12	434	4.4e-108	0.7940140845070423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	0.0	8	434	45	463	choline dehydrogenase; Validated
225186	BetA	8.69e-120	4	434	40	464	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
366272	GMC_oxred_N	1.58e-56	39	269	15	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
239398	alpha_CA_prokaryotic_like	2.87e-28	520	644	58	175	Carbonic anhydrase alpha, prokaryotic-like subfamily. Carbonic anhydrases (CAs) are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism: a nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site. They are ubiquitous enzymes involved in fundamental processes like photosynthesis, respiration, pH homeostasis and ion transport. Most alpha CAs are monomeric enzymes. The zinc ion is complexed by three histidines. This sub-family includes bacterial carbonic anhydrase alpha, as well as plant enzymes such as tobacco nectarin III and yam dioscorin and, carbonic anhydrases from molluscs, such as nacrein, which are part of the organic matrix layer in shells. Other members of this family may be involved in maintaining pH balance, in facilitating transport of carbon dioxide or carbonic acid, or in sensing carbon dioxide levels in the environment. Dioscorin is the major storage protein of yam tubers and may play a role as an antioxidant. Tobacco Nectarin may play a role in the maintenace of pH and oxidative balance in nectar. Mollusc nacrein may participate in calcium carbonate crystal formation of the nacreous layer. This subfamily also includes three alpha carbonic anhydrases from Chlamydomonas reinhardtii (CAH 1-3). CAHs1-2 are localized in the periplasmic space. CAH1 faciliates the movement of carbon dioxide across the plasma membrane when the medium is alkaline. CAH3 is localized to the thylakoid lumen and provides CO2 to Rubisco.
238200	alpha_CA	9.53e-24	517	653	47	195	Carbonic anhydrase alpha (vertebrate-like) group. Carbonic anhydrases (CAs) are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism: a nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site. They are ubiquitous enzymes involved in fundamental processes like photosynthesis, respiration, pH homeostasis and ion transport. There are three evolutionary distinct groups - alpha, beta and gamma carbonic anhydrases - which show no significant sequence identity or structural similarity. Most alpha CAs are monomeric enzymes. The zinc ion is complexed by three histidine residues and a fourth conserved histidine plays a potential role in proton transfer.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28087.1|AA3_2	2.50e-197	2	434	63	489
CAB3230510.1|AA3_2	2.98e-151	4	434	65	485
ANI26486.1|AA3_2	1.43e-149	5	434	108	531
AWP09430.1|AA3_2	3.63e-145	8	434	64	480
CEF60566.1|AA3_2	4.69e-121	10	432	75	495

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZH7_A	3.45e-50	13	434	50	490	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YRU_AAA	3.45e-50	13	434	50	490	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS1_AAA	3.45e-50	13	434	50	490	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
5NCC_A	4.44e-50	13	434	66	506	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]
6YS2_AAA	6.50e-50	13	434	50	490	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8NE62|CHDH_HUMAN	3.10e-155	8	434	85	501	Choline dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=CHDH PE=1 SV=2
sp|Q6UPE0|CHDH_RAT	3.25e-153	10	434	92	506	Choline dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Chdh PE=1 SV=1
sp|Q8BJ64|CHDH_MOUSE	5.91e-153	10	434	89	503	Choline dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Chdh PE=1 SV=1
sp|B0CKN4|BETA_BRUSI	3.17e-127	11	432	43	453	Oxygen-dependent choline dehydrogenase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) OX=470137 GN=betA PE=3 SV=1
sp|A5VPA6|BETA_BRUO2	3.17e-127	11	432	43	453	Oxygen-dependent choline dehydrogenase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) OX=444178 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.997849	0.002214

TMHMM  Annotations     

There is no transmembrane helices in KAG6606618.1.