CAZyme Information: KAG6599569.1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: KAG6599569.1
• CAZy Family: GH140
• CAZyme Description: Mannan polymerase complex subunit mnn9

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
534		60323.72	6.7248

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiGKB4	19981	N/A	0	19981

• Gene Location: location=JAFJYM010000067:148089-149693(+)

Full Sequence      

MHAGKANRRGFFYLFAGIVVFWLWIQSRGAPTTALVRAREESMSPSRPHVAGINEQNLLS
TPHGHQATAPQQPVPGIPQSNTYVPDETVTEAPEEPQSNTKKQPAPNTPEQQPVPGIPQP
NTPKDPYEPDEAETEAPEEPQSNTKKQPAPNTPEQQPVPGIPQPNTPKDSYKPKEAETEA
PKQPQPNTIKQPAPNTPEPPVTSVLHPITPPQDPLNPDVAFRIQSTKTQFDEYEESFPQY
GKTEPGRHYRIENTPLLSKLGNRESNSVLIICVFNDAESWGKNRTVNDFFNLVGSFNYPK
EKISIAMLTSSLNEFGTVRTLFPNYIQHYPRLSVMFRNDFAQEGLTRSNRHDHALQGDRR
RMLARYRNYALLSMMESWHQHVVWLDADVTVVPSGLVQKMVHSGRDIVEPICLRKINDKW
HNYDGNAWVGQRKVRSAEQDGSNFVPGPLNAKHMHNMPDKDKEFAPLDSVGGTMLYVRAE
IHRQGVVFPMHYVIGSEWGREGYDGIETEGLCYTAHFLGYKCWGMPKDVIQHAW

Enzyme Prediction     

No EC number prediction in KAG6599569.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT62	261	490	2.4e-42	0.9216417910447762

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397491	Anp1	2.80e-42	260	489	17	262	Anp1. The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.
411408	PspC_subgroup_2	9.05e-12	59	199	347	484	pneumococcal surface protein PspC, LPXTG-anchored form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site. The other form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A.
411408	PspC_subgroup_2	2.65e-11	43	214	299	477	pneumococcal surface protein PspC, LPXTG-anchored form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site. The other form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A.
411408	PspC_subgroup_2	3.16e-11	30	198	266	430	pneumococcal surface protein PspC, LPXTG-anchored form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site. The other form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A.
411408	PspC_subgroup_2	1.10e-10	70	214	284	433	pneumococcal surface protein PspC, LPXTG-anchored form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site. The other form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR43931.1|GT62	3.36e-54	233	532	164	468
CAG86269.2|GT62	2.30e-52	253	533	82	397
SGZ55043.1|GT62	3.49e-51	266	533	85	376
SGZ55181.1|GT62	3.49e-51	266	533	85	376
UJR11041.1|GT62	1.21e-49	266	533	66	368

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZF8_A	4.88e-18	297	532	48	299	Crystal structure of Saccharomyces cerevisiae Mnn9 in complex with GDP and Mn. [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O36022|MNN9_SCHPO	3.14e-22	297	532	89	334	Mannan polymerase complex subunit mnn9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mnn9 PE=3 SV=1
sp|O74745|ANP1_SCHPO	5.29e-22	286	534	113	373	Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=anp1 PE=3 SV=1
sp|Q00314|VAN1_CANAX	1.61e-18	291	534	173	420	Vanadate resistance protein OS=Candida albicans OX=5476 GN=VAN1 PE=3 SV=1
sp|P39107|MNN9_YEAST	1.55e-17	297	532	138	389	Mannan polymerase complexes subunit MNN9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN9 PE=1 SV=3
sp|P32629|ANP1_YEAST	1.64e-17	289	534	99	356	Mannan polymerase II complex ANP1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ANP1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.816455	0.183556

TMHMM  Annotations     

Start	End
9	26