CAZyme Information: KAG6590985.1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: KAG6590985.1
• CAZy Family: GH1
• CAZyme Description: Inositol phosphoceramide mannosyltransferase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
342		39420.58	7.2078

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiGKB4	19981	N/A	0	19981

• Gene Location: location=JAFJYM010000084:370019-371047(-)

Full Sequence      

MSSRMGVPARLKALQTPHNLLVESLRRSSDPDKEADDGPAGHRSKQNWSADNSTEALTNT
GGIPHIIHQSWKNVYRIPTRFHPWMKSWKDMHPTWTYVFWTDEDNLRLFQQLYPQYLHVA
KAVKKVSLADMARYALLHRVGGLYVDADFECLQPFDDLHRDSRLFLSSEPLVHTVLLEKS
TSDSVALCNALMASAPGHPFWLQVLDNIKDKFDRERLRSDAVALTGPRMVKQTYLSQKSA
AGSDIVVFPSEYFYPEVAYWNIEPMEQACRRRYDDDARRACDWLHKFPRGEFTSKTHATH
HWQCTWCRDAQLDEFGPLRDVFESAPMRPSISSTGVEFVALH

Enzyme Prediction     

No EC number prediction in KAG6590985.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	83	159	1e-17	0.9111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.59e-17	63	227	82	233	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.86e-10	86	158	9	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
368570	Caps_synth	2.02e-04	86	200	70	180	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADI10024.1|GT2|GT32|GT62	6.40e-34	57	309	1	227
QDT07304.1|GT32	1.29e-32	63	255	3	189
UCI31329.1|GT32|GT62	2.26e-31	63	306	2	215
AQW50986.1|GT2|GT32|GT62	9.42e-31	62	309	6	227
ASQ94832.1|GT2|GT32|GT62	4.28e-30	62	309	6	227

PDB Hits     

KAG6590985.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10323|IMT3_SCHPO	1.10e-17	60	208	54	188	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	1.34e-15	63	209	82	214	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|P38287|CSH1_YEAST	2.28e-15	63	209	62	194	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	1.93e-14	63	212	55	192	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|O14084|IMT1_SCHPO	4.12e-14	63	208	64	199	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000066	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KAG6590985.1.