CAZyme Information: KAG6586930.1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: KAG6586930.1
• CAZy Family: CE8
• CAZyme Description: Pectate lyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
410		43486.12	8.0182

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiGKB4	19981	N/A	0	19981

• Gene Location: location=JAFJYM010000094:119637-120869(-)

Full Sequence      

MGRVRLLVAAALAIVARSAHAITIGSPIGMATGTTGGGDVAPVYPNTTKELVAYLRDPAP
RVVILTKTFDFRGLEGKTTAEGCRPDYTRRCMALNNGFKSQDVILQEGGMSNTSACKNGT
SVTVTFDNAPFNRLNVRGNKTIRGIGNKGVIVGKGLGLNGHNIIVQNIHITEINAHLVWG
GDAITVQGLSDGTIPLENIWLDHIKISRIGRQFIAVNKAGASSMTISNSDFDGQTEFSKT
CDGHHYWGLHFSGKHTGVSIINNYIHYLSGHLPKVGGIADTSVVVHVANNYYKDNSFHGM
EIGTNGYVLAEGNYFVNTTEPLYNGGDPDIIGMVDGSIYAPVKSSKDECAAALGRVCGEN
VLEASGAFGSRKGATALAETKSRSSIARFSPKQAQELDLAASNFGVGELN

Enzyme Prediction     

EC	4.2.2.10:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	123	317	5.1e-75	0.9946524064171123

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	9.27e-33	122	318	2	189	Amb_all domain.
226384	PelB	4.57e-11	123	322	84	280	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	8.16e-07	135	315	31	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHX74066.1|PL1_4	1.04e-228	1	409	1	409
ACR19246.1|PL1_4	4.24e-228	1	409	1	409
AHX74068.1|PL1_4	4.29e-164	10	410	10	400
ADN18834.1|PL1_4	8.63e-164	10	410	10	400
ADN18833.1|PL1_4	2.17e-159	17	410	17	400

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QCX_A	2.60e-73	24	368	4	322	Pectin Lyase B [Aspergillus niger]
1IDJ_A	9.84e-70	25	368	5	321	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
1IDK_A	8.47e-68	25	368	5	321	Pectin Lyase A [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BA61|PELB_EMENI	1.30e-81	12	368	11	341	Pectin lyase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pelB PE=2 SV=1
sp|B0XT36|PELA_ASPFC	1.00e-80	25	368	23	340	Probable pectin lyase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pelA PE=3 SV=1
sp|Q0CYL8|PELA_ASPTN	1.00e-80	25	370	24	342	Probable pectin lyase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelA PE=3 SV=1
sp|Q4WIS6|PELB_ASPFU	1.00e-80	25	368	23	340	Probable pectin lyase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pelB PE=3 SV=1
sp|A1CFS2|PELA_ASPCL	1.00e-80	25	368	23	340	Probable pectin lyase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=pelA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000211	0.999749	CS pos: 21-22. Pr: 0.9752

TMHMM  Annotations     

There is no transmembrane helices in KAG6586930.1.