CAZyme Information: KAG6586684.1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: KAG6586684.1
• CAZy Family: CE8
• CAZyme Description: Transmembrane and TPR repeat-containing protein 4

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
381		40818.09	6.7292

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiGKB4	19981	N/A	0	19981

• Gene Location: location=JAFJYM010000097:343898-346282(-)

Full Sequence      

MLLDVSPREASALLVFLAALLTAWTANGNGFVWDDRSAVLANEDAQSSGLGDVFAHDFWG
THIRSARSHKSYRPLAVLSFRLNFLLAGGHSAWLYHCTNALVHAACSVLVWTVADELFQQ
HERRLAVDRGNENPQDASPTAANGETKAAIGGEGGALVGPVTAGLLFAVHPIHCDAVASI
VGRADLLCTALCLLAFLAYAREAGGGGVQWTGVALALALTIAAGLCKELGFTNFALLVAY
DLLRIHHYQSVAGGMQLMKRRIGVTVDPELLVEASSIYNMLGVCYRKKGDADTALEMLRK
GIALYPEETDLHINAAMILLHQGKQMEADAQLKAGLIAATLPGHIQKLRNIAKMLEVSKM
EKAVEVILDRAAALERQYSGS

Enzyme Prediction     

EC	2.4.1.109:6

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT105	82	246	4.2e-33	0.9312977099236641

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
276809	TPR	2.85e-07	269	336	29	96	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
276809	TPR	2.84e-06	277	365	3	90	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
223533	TPR	0.001	273	359	200	284	Tetratricopeptide (TPR) repeat [General function prediction only].
395414	TPR_1	0.002	277	307	3	33	Tetratricopeptide repeat.
274350	PEP_TPR_lipo	0.003	276	377	466	565	putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAC30236.1|GT105	3.40e-34	7	260	18	254
CAD7262125.1|GT105	8.88e-34	7	246	129	340
CAD7202138.1|GT105	1.93e-33	7	246	46	257
BAC25886.1|GT105	2.60e-33	7	260	18	254
CAB1313465.1|GT105	4.54e-33	24	304	21	242

PDB Hits     

KAG6586684.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8BG19|TMTC4_MOUSE	8.27e-34	7	260	18	254	Protein O-mannosyl-transferase TMTC4 OS=Mus musculus OX=10090 GN=Tmtc4 PE=2 SV=1
sp|Q5T4D3|TMTC4_HUMAN	5.13e-33	4	245	15	239	Protein O-mannosyl-transferase TMTC4 OS=Homo sapiens OX=9606 GN=TMTC4 PE=1 SV=2
sp|Q8BRH0|TMTC3_MOUSE	5.15e-32	4	248	8	214	Protein O-mannosyl-transferase TMTC3 OS=Mus musculus OX=10090 GN=Tmtc3 PE=1 SV=2
sp|Q6ZXV5|TMTC3_HUMAN	1.71e-31	24	248	21	209	Protein O-mannosyl-transferase TMTC3 OS=Homo sapiens OX=9606 GN=TMTC3 PE=1 SV=2
sp|Q9V3X5|TMTC2_DROME	2.33e-31	28	244	51	236	Protein O-mannosyl-transferase TMTC2 OS=Drosophila melanogaster OX=7227 GN=CG4341 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.023203	0.976746	CS pos: 28-29. Pr: 0.8958

TMHMM  Annotations     

Start	End
10	32
150	172
177	199
206	225