CAZyme Information: KAG6584716.1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: KAG6584716.1
• CAZy Family: AA7
• CAZyme Description: glycoside hydrolase family 6 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
318		34169.98	4.1592

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiGKB4	19981	N/A	0	19981

• Gene Location: location=JAFJYM010000103:282613-283569(+)

Full Sequence      

MGIATWYSDRDVNGNATQTALDLVAACPESSRLSVVVYGLPNKDCDAGYSNGNGTVKTGA
DYEEFITNLTALVGERKVLYVLEPDAVGLLANKGCAVEYGYQSNLTTAISLLSENPNAEI
YLDVGFWTLERSDTADIVAQIVKELAQAGRVKGIALNTSNYRSTTQIAELCTNFQTAVGS
TDIHCVIDTSRNFQEFANASSTEWCNVRKAGIGAPPTNITDLDNIDYLVYVKPPGDSDGT
CVDQSADAMRGPPAGEFFNDHFIKLWNQGYFVNQQQMASIYDPDAESSAIGASASSWFTT
AITLAVTSHLACGLMNAR

Enzyme Prediction     

No EC number prediction in KAG6584716.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH6	4	242	7.2e-56	0.8741496598639455

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396075	Glyco_hydro_6	7.99e-43	2	241	15	287	Glycosyl hydrolases family 6.
227616	CelA1	4.66e-20	25	270	178	440	Cellulase/cellobiase CelA1 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ23641.1|GH6	8.89e-96	3	280	58	332
UIZ23635.1|GH6	3.99e-92	3	282	54	324
CCA16954.1|GH6	2.41e-83	3	282	53	330
AIG55947.1|GH6	1.90e-77	3	275	47	304
AIG55974.1|GH6	2.36e-76	3	275	56	319

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JX5_A	4.66e-31	30	265	65	314	GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102],5JX5_B GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102],5JX5_C GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102],5JX5_D GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102],6IDW_A GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102],6IDW_B GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102],6IDW_C GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102],6IDW_D GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102]
1UP2_A	1.95e-24	35	265	73	288	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with glucose-isofagomine at 1.9 angstrom [Mycobacterium tuberculosis H37Rv]
1UP3_A	2.71e-24	35	265	73	288	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with METHYL-CELLOBIOSYL-4-DEOXY-4-THIO-BETA-D-CELLOBIOSIDE at 1.6 angstrom [Mycobacterium tuberculosis H37Rv]
1UP0_A	2.71e-24	35	265	73	288	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with cellobiose at 1.75 angstrom [Mycobacterium tuberculosis H37Rv]
1UOZ_A	3.84e-24	35	265	94	309	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with thiocellopentaose at 1.1 angstrom [Mycobacterium tuberculosis H37Rv]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QYR9|CBHC_ASPNC	2.44e-22	36	265	181	451	Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=cbhC PE=3 SV=1
sp|P46236|GUNB_FUSOX	1.17e-21	36	265	182	453	Putative endoglucanase type B OS=Fusarium oxysporum OX=5507 PE=2 SV=1
sp|Q7SIG5|GUN6_HUMIN	2.04e-21	29	268	77	340	Endoglucanase-6B OS=Humicola insolens OX=34413 GN=cel6B PE=1 SV=1
sp|Q5B2E8|CBHC_EMENI	1.79e-20	36	265	177	447	1,4-beta-D-glucan cellobiohydrolase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cbhC PE=1 SV=2
sp|Q0CFP1|CBHC_ASPTN	4.78e-20	36	265	190	460	Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=cbhC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.997588	0.002441

TMHMM  Annotations     

There is no transmembrane helices in KAG6584716.1.