CAZyme Information: KAG6583231.1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: KAG6583231.1
• CAZy Family: AA7
• CAZyme Description: putative glycosyl hydrolase family 5 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
345	JAFJYM010000105|CGC7	38561.76	4.7853

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiGKB4	19981	N/A	0	19981

• Gene Location: location=JAFJYM010000105:1050385-1051422(+)

Full Sequence      

MTAEAAFWGGVDDRVANSGEYTTITKAASPDDVRSKLGDHHMTFISEDDIEQIAAAGLNT
VRVPLGFWILGYDNHDPSNQHEWLAYTRGTIVFLDQLIRCWAKTHNVAVLISIHAAKGSQ
NGADHSSPASPGHSFWSQYPENVANTIEVARFLADRYLHDEAFLGIGLLNEPSGSTDQTV
LYQFYQDAYRAVRSTGSDCVLSVAPMLQKQSPNEMVGFMEAPAFTNVWVEWHPYFIWGYE
HTPDDELVNVAVKQEYKARVDQWNARAGHNRLFIGEWSMATASNMRKNNPAAFYSFAAEQ
LKVHDEAEGGWTLWTWKASGSGTEDWALQNLLADDRLNGLLRSDA

Enzyme Prediction     

No EC number prediction in KAG6583231.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	37	319	4.3e-47	0.9675090252707581

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	7.58e-20	29	331	58	375	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	6.11e-08	44	320	24	272	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29004.1|GH5	9.02e-206	1	342	63	407
UIZ29069.1|GH5	3.23e-135	1	341	74	413
AAM18484.1|GH5	3.97e-95	1	334	35	365
UIZ29723.1|GH5	9.32e-95	1	334	27	357
CCA17636.1|GH5	6.88e-94	1	341	153	498

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2PC8_A	8.04e-25	37	331	67	378	Chain A, Hypothetical protein XOG1 [Candida albicans]
3N9K_A	1.09e-24	37	331	66	377	F229A/E292S Double Mutant of Exo-beta-1,3-glucanase from Candida albicans in Complex with Laminaritriose at 1.7 A [Candida albicans]
1EQP_A	1.94e-24	37	331	61	372	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
1CZ1_A	1.94e-24	37	331	61	372	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
4M80_A	2.05e-24	37	331	66	377	The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans at 1.85A resolution [Candida albicans SC5314],4M81_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with 1-fluoro-alpha-D-glucopyranoside (donor) and p-nitrophenyl beta-D-glucopyranoside (acceptor) at 1.86A resolution [Candida albicans SC5314],4M82_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with p-nitrophenyl-gentiobioside (product) at 1.6A resolution [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q96V64|EXG_BLUGR	2.27e-29	16	331	61	397	Glucan 1,3-beta-glucosidase OS=Blumeria graminis OX=34373 PE=3 SV=1
sp|A1CRV0|EXGA_ASPCL	9.82e-29	23	334	74	398	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=exgA PE=3 SV=2
sp|O93983|EXG2_WICAO	2.98e-28	25	331	80	407	Glucan 1,3-beta-glucosidase 2 OS=Wickerhamomyces anomalus OX=4927 GN=EXG2 PE=3 SV=1
sp|B0XN12|EXGA_ASPFC	4.94e-28	23	334	74	399	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1
sp|Q12700|EXG_SCHOC	7.59e-28	12	332	70	405	Glucan 1,3-beta-glucosidase OS=Schwanniomyces occidentalis OX=27300 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000030	0.000011

TMHMM  Annotations     

There is no transmembrane helices in KAG6583231.1.