CAZyme Information: KAG6583200.1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: KAG6583200.1
• CAZy Family: AA6|AA6
• CAZyme Description: putative hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
197		21483.11	6.6399

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiGKB4	19981	N/A	0	19981

• Gene Location: location=JAFJYM010000105:908319-908912(-)

Full Sequence      

MHGSRQCRRIHRRLAHELRLGRLQDASQVVRQRRPPVDHLPISDVTSIPSTIQFKYDYDG
GLIANVAYDLFTSSTADGDAEYEIMVWLATIGGAGPLSNTGSAVAQVAVGGVDFELYHGK
NGNITVYSFVAPTIVNSYSTDLKQFFDNLPANLTIAPTQYLINVQAGTEPFVGNGTLTVS
KYSAAVKTAEYSQIQQQ

Enzyme Prediction     

EC	3.2.1.151:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH12	41	186	9.8e-40	0.9743589743589743

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396303	Glyco_hydro_12	3.95e-38	42	186	61	206	Glycosyl hydrolase family 12.
235746	PRK06215	3.73e-11	41	143	101	193	hypothetical protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABB22027.1|GH12	4.96e-89	38	197	92	251
ABB22026.1|GH12	2.71e-80	38	189	92	243
ABB22034.1|GH12	3.72e-62	38	189	90	242
ABG91065.1|GH12	3.55e-60	42	188	96	243
ABB22025.1|GH12	1.64e-58	42	189	95	243

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4NPR_A	1.70e-42	42	186	98	242	Crystal Structure of the Family 12 Xyloglucanase from Aspergillus niveus [Aspergillus niveus],4NPR_B Crystal Structure of the Family 12 Xyloglucanase from Aspergillus niveus [Aspergillus niveus]
3VLB_B	7.62e-42	45	187	80	222	Crystal structure of xeg-edgp [Aspergillus aculeatus],3VLB_D Crystal structure of xeg-edgp [Aspergillus aculeatus]
3VL8_A	9.24e-42	45	187	87	229	Crystal structure of XEG [Aspergillus aculeatus],3VL9_A Crystal structure of xeg-xyloglucan [Aspergillus aculeatus],3VL9_B Crystal structure of xeg-xyloglucan [Aspergillus aculeatus]
5GM3_A	1.50e-31	42	187	73	219	Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 [Aspergillus aculeatus],5GM3_B Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 [Aspergillus aculeatus]
4H7M_A	3.53e-31	42	186	80	224	The X-ray Crystal Structure of the Trichoderma harzianum Endoglucanase 3 from family GH12 [Trichoderma harzianum],4H7M_B The X-ray Crystal Structure of the Trichoderma harzianum Endoglucanase 3 from family GH12 [Trichoderma harzianum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|W2PDG1|XLP1_PHYPN	5.23e-48	42	186	92	237	Inactive glycoside hydrolase XLP1 OS=Phytophthora parasitica (strain INRA-310) OX=761204 GN=XLP1 PE=1 SV=1
sp|Q5BG78|XGEA_EMENI	3.04e-47	42	186	94	238	Xyloglucan-specific endo-beta-1,4-glucanase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xgeA PE=1 SV=1
sp|G4ZHR2|XEG1_PHYSP	5.15e-46	42	186	94	240	Xyloglucan-specific endo-beta-1,4-glucanase 1 OS=Phytophthora sojae (strain P6497) OX=1094619 GN=XEG1 PE=1 SV=1
sp|Q0CRC9|XGEA_ASPTN	1.87e-45	42	186	105	249	Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=xgeA PE=3 SV=2
sp|W2PEP3|XEG1_PHYPN	3.28e-44	42	186	94	240	Xyloglucan-specific endo-beta-1,4-glucanase 1 OS=Phytophthora parasitica (strain INRA-310) OX=761204 GN=XEG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KAG6583200.1.