CAZyme Information: KAG6580370.1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: KAG6580370.1
• CAZy Family: AA3|GT20
• CAZyme Description: ER degradation-enhancing alpha-mannosidase-like protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
720		79662.20	5.3560

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiGKB4	19981	N/A	0	19981

• Gene Location: location=JAFJYM010000109:53742-57416(-)

Full Sequence      

MLPRQHQARHGDGRGAAYRASRYAWGATVKRACTCAFLLSFALLFVSVGAAPSENGAKSD
GESQPPVLSHFNGLHTLSGASYRAFKNRLKRQMRGESCLRYHVAGTWWHYEWCVDKHVRQ
FHPQPAGPKAQKPKELSILLGAYNAEKPQPLRVLAVDNLARLADPDRMGYMAQQLYGSGD
YCEERGAPRMVKLQVKCCAFHDNETYVDSVEEKAPCEYEMNVCSPVACGLMQRDQFVLTA
PTYMEGEERKALAKTVRDMFYHAYNGYLKHAFPQDDLLPLSCRGGEFELGRLPMLTLVDT
LDTLAVLEDATEFRRAVELVVENADFNLDTEVSVFETTIRLLGGLLSAHLFAVNTDLKLY
PDGDYDGALLRLAVDLGVRLMPAFDTVTGIPYGTVNLKHGVPKGETPIASTAGAGSLSIE
FTMLSVLTGDPKYAAASRGAVRALFQRRSKIGLLGKHINTKNGDWTETSSGPGSNSDSFY
EYLLKMYELFGDREALEMFAQVYPAVLAHNKHGDCFKASRAFPNMELVVADPVDACSEVS
NLPEERLRGKIVLAQRGECFFETKARNAEKWGAAGVIIVNTEDDDLVMVMGGVDENSAEA
TDEPLDIPVVMVPERLGEWFETRLVEAEASSLAPVVVSIELTVRHHDREVDQTRRRGRGI
SGDRSFPRIDGTADNMKVYGPVWGVELITMGSDSENGQDQEDDHQESFTIAIVGTPPWQH

Enzyme Prediction     

EC	3.2.1.113:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	259	513	1.2e-82	0.5605381165919282

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	2.84e-87	259	511	1	250	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	2.08e-49	253	509	73	322	glycoside hydrolase family 47 protein; Provisional
239038	PA_C_RZF_like	2.08e-20	527	618	44	131	PA_C-RZF_ like: Protease-associated (PA) domain C_RZF-like. This group includes various PA domain-containing proteins similar to C-RZF (chicken embryo RING zinc finger) protein. These proteins contain a C3H2C3 RING finger. C-RZF is expressed in embryo cells and is restricted mainly to brain and heart, it is localized to both the nucleus and endosomes. Additional C3H2C3 RING finger proteins belonging to this group, include Arabidopsis ReMembR-H2 protein and mouse sperizin. ReMembR-H2 is likely to be an integral membrane protein, and to traffic through the endosomal pathway. Sperizin is expressed in haploid germ cells and localized in the cytoplasm, it may participate in spermatogenesis. The significance of the PA domain to these proteins has not been ascertained. It may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate.
239047	PA_GO-like	1.92e-17	498	618	22	123	PA_GO-like: Protease-associated domain containing proteins like Arabidopsis thaliana growth-on protein GRO10. This group contains various PA domain-containing proteins similar to the functionally uncharacterized Arabidopsis GRO10. The PA domain may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate.
240122	PA_subtilisin_1	4.31e-17	526	613	20	97	PA_subtilisin_1: Protease-associated domain containing subtilisin-like proteases, subgroup 1. A subgroup of PA domain-containing subtilisin-like proteases. The significance of the PA domain to many of the proteins in which it is inserted is undetermined. It may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate. Proteins into which the PA domain is inserted include the following subtilisin-like proteases: i) melon cucumisin, ii) Arabidopsis thaliana Ara12, iii) Alnus glutinosa ag12, iv) members of the tomato P69 family, and v) tomato LeSBT2. However, these proteins belong to other subtilisin-like subgroups. Relatively little is known about proteins in this subgroup.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ27914.1|GH47	2.03e-225	171	717	1	1042
AIG56334.1|GH47	3.68e-146	89	516	39	447
AIG55397.1|GH47	1.21e-137	98	516	33	443
QCE07576.1|GH47	6.81e-78	247	512	30	292
BAT94804.1|GH47	9.27e-78	247	512	30	292

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4AYO_A	5.31e-38	247	509	8	258	Structure of The GH47 processing alpha-1,2-mannosidase from Caulobacter strain K31 [Caulobacter sp. K31],4AYP_A Structure of The GH47 processing alpha-1,2-mannosidase from Caulobacter strain K31 in complex with thiomannobioside [Caulobacter sp. K31],4AYQ_A Structure of The GH47 processing alpha-1,2-mannosidase from Caulobacter strain K31 in complex with mannoimidazole [Caulobacter sp. K31],4AYR_A Structure of The GH47 processing alpha-1,2-mannosidase from Caulobacter strain K31 in complex with noeuromycin [Caulobacter sp. K31],5MEH_A Crystal structure of alpha-1,2-mannosidase from Caulobacter K31 strain in complex with 1-deoxymannojirimycin [Caulobacter sp. K31],5NE5_A Crystal structure of family 47 alpha-1,2-mannosidase from Caulobacter K31 strain in complex with kifunensine [Caulobacter sp. K31]
5KKB_A	1.04e-37	256	512	26	274	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]
1NXC_A	1.20e-37	256	512	24	272	Structure of mouse Golgi alpha-1,2-mannosidase IA reveals the molecular basis for substrate specificity among Class I enzymes (family 47 glycosidases) [Mus musculus]
5KIJ_A	2.88e-34	254	509	7	253	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
5KK7_A	3.02e-34	254	509	7	253	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9FG93|MNS4_ARATH	8.21e-75	247	509	35	294	Alpha-mannosidase I MNS4 OS=Arabidopsis thaliana OX=3702 GN=MNS4 PE=1 SV=1
sp|Q9SXC9|MNS5_ARATH	1.94e-67	228	513	13	310	Alpha-mannosidase I MNS5 OS=Arabidopsis thaliana OX=3702 GN=MNS5 PE=1 SV=1
sp|Q8BJT9|EDEM2_MOUSE	7.65e-67	239	516	28	297	ER degradation-enhancing alpha-mannosidase-like protein 2 OS=Mus musculus OX=10090 GN=Edem2 PE=1 SV=1
sp|Q9BV94|EDEM2_HUMAN	4.01e-66	256	516	39	297	ER degradation-enhancing alpha-mannosidase-like protein 2 OS=Homo sapiens OX=9606 GN=EDEM2 PE=1 SV=2
sp|Q925U4|EDEM1_MOUSE	1.56e-62	249	513	122	401	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Mus musculus OX=10090 GN=Edem1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.606860	0.393130

TMHMM  Annotations     

There is no transmembrane helices in KAG6580370.1.