CAZyme Information: KAG6580098.1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: KAG6580098.1
• CAZy Family: AA2|AA2
• CAZyme Description: Pectate lyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
448		46717.12	9.6558

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiGKB4	19981	N/A	0	19981

• Gene Location: location=JAFJYM010000112:272759-274105(+)

Full Sequence      

MCDASVVKGTAPGFAVGTSGGGNANPIVPNTISELVSALSGNEPRVIVLKKGFNFVNTEG
SKKEKGCRRQNNIDCLAKKNGFLGQDSIQPSFTSCDGTVINVAYDNAALTPLTVGSNKTL
VGEGTKGVLNGKGLMITGSNVIIQNIHITNLNPHLVWGGDAITIRGDGKNAPKGIWIDHV
KISSIGRQMIVINFSGVTGLTISNSDFDGRTKYSTSCDGRHYWGFLLLGKRTELSLIGNY
IHHTSGRSPKVGGHNGETTVVYAANNYFYDNSGHAFDVSTGGYALAEGNYFDSVKLPTAN
DPKGNFLVPMVASDCKASIGRDCKLNVLANSGSLKGTSQGKVASQLVNVKTLINQFKVAS
AIKFSVGTGNFGVGGLGNSATQSSTKQSDGKQGNNTAQSSPKQSDGKNGNNTAQSSAQTS
SSQSTSQTSPSQPSPTESVVQTDGNHKL

Enzyme Prediction     

EC	4.2.2.10:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	101	292	7.8e-81	0.9893048128342246

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	1.24e-34	99	295	1	190	Amb_all domain.
226384	PelB	6.47e-14	17	299	47	281	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	7.77e-09	105	291	23	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR19253.2|PL1_4	2.62e-192	4	385	23	413
ACR19250.1|PL1_4	1.63e-179	5	388	190	573
ACR19256.1|PL1_4	3.75e-179	4	321	29	346
ACR19247.1|PL1_4|4.2.2.10	2.51e-125	9	378	25	400
ACR19251.1|PL1_4	3.55e-125	9	378	25	400

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QCX_A	1.29e-87	7	337	3	325	Pectin Lyase B [Aspergillus niger]
1IDJ_A	1.42e-83	7	370	3	358	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
1IDK_A	3.14e-82	7	370	3	358	Pectin Lyase A [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CZD4|PELF2_ASPTN	3.32e-101	7	385	23	394	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1
sp|B8N316|PELF_ASPFN	1.09e-91	4	388	20	399	Probable pectin lyase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelF PE=3 SV=1
sp|Q2UJA7|PELF_ASPOR	3.06e-91	4	388	20	399	Probable pectin lyase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelF PE=3 SV=2
sp|Q5BA61|PELB_EMENI	8.72e-90	4	335	19	342	Pectin lyase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pelB PE=2 SV=1
sp|Q8NJK6|PELF_ASPNG	9.64e-90	7	385	24	392	Probable pectin lyase F OS=Aspergillus niger OX=5061 GN=pelF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KAG6580098.1.