CAZyme Information: KAG6580055.1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: KAG6580055.1
• CAZy Family: AA2
• CAZyme Description: Cell 12A endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
241	JAFJYM010000113|CGC1	25342.39	8.7881

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiGKB4	19981	N/A	0	19981

• Gene Location: location=JAFJYM010000113:135788-136513(+)

Full Sequence      

MKGFFAGAIAAATLAVASAGEYCGQWDWAKSTNYIVYNNLWNKNAAASGSQCTGVDKISG
STIGWHTSYTWTGGAATEVKSYSNAALIFTPKQLSSISTIPTKMKYSYSHSSGTFVADVA
YDLFTSSTASGSNEYEIMIWLAAYGGAGPISSTGKAIATVTIGSNSFKLYKGPNGSTTVF
SFVATKTITNFSADLQKFLSYLINSQGLPSSQYLITLEAGTEPFVGTNAKMTVSSFSAAV
N

Enzyme Prediction     

EC	3.2.1.4:15	3.2.1.151:9

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH12	91	240	6e-45	0.9871794871794872

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396303	Glyco_hydro_12	8.68e-50	34	241	3	207	Glycosyl hydrolase family 12.
235746	PRK06215	2.84e-16	23	207	41	203	hypothetical protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGZ16757.1|GH12|3.2.1.151	3.24e-159	1	241	1	241
ABB22029.1|GH12|3.2.1.151	3.24e-159	1	241	1	241
ABB22036.1|GH12	6.09e-143	1	241	1	239
ABB22037.1|GH12	1.07e-124	1	241	1	237
ABB92621.1|GH12	3.04e-99	1	180	1	180

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VLB_B	9.41e-88	21	240	6	221	Crystal structure of xeg-edgp [Aspergillus aculeatus],3VLB_D Crystal structure of xeg-edgp [Aspergillus aculeatus]
3VL8_A	1.19e-87	21	240	13	228	Crystal structure of XEG [Aspergillus aculeatus],3VL9_A Crystal structure of xeg-xyloglucan [Aspergillus aculeatus],3VL9_B Crystal structure of xeg-xyloglucan [Aspergillus aculeatus]
4NPR_A	1.36e-77	16	240	21	242	Crystal Structure of the Family 12 Xyloglucanase from Aspergillus niveus [Aspergillus niveus],4NPR_B Crystal Structure of the Family 12 Xyloglucanase from Aspergillus niveus [Aspergillus niveus]
5GM3_A	7.00e-54	21	240	2	218	Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 [Aspergillus aculeatus],5GM3_B Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 [Aspergillus aculeatus]
6K9D_A	1.92e-53	23	241	4	218	Chain A, GH12 beta-1, 4-endoglucanase [Aspergillus fischeri]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G4ZHR2|XEG1_PHYSP	5.75e-160	1	241	1	241	Xyloglucan-specific endo-beta-1,4-glucanase 1 OS=Phytophthora sojae (strain P6497) OX=1094619 GN=XEG1 PE=1 SV=1
sp|W2PEP3|XEG1_PHYPN	6.71e-159	1	241	1	241	Xyloglucan-specific endo-beta-1,4-glucanase 1 OS=Phytophthora parasitica (strain INRA-310) OX=761204 GN=XEG1 PE=1 SV=1
sp|W2PDG1|XLP1_PHYPN	6.58e-124	1	241	1	238	Inactive glycoside hydrolase XLP1 OS=Phytophthora parasitica (strain INRA-310) OX=761204 GN=XLP1 PE=1 SV=1
sp|G4ZHR3|XLP1_PHYSP	5.41e-100	1	180	1	180	Inactive glycoside hydrolase XLP1 OS=Phytophthora sojae (strain P6497) OX=1094619 GN=XLP1 PE=1 SV=1
sp|O94218|XGEA_ASPAC	2.89e-87	12	240	9	237	Xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus aculeatus OX=5053 GN=xgeA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000201	0.999750	CS pos: 19-20. Pr: 0.9729

TMHMM  Annotations     

There is no transmembrane helices in KAG6580055.1.