CAZyme Information: KAG6580009.1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: KAG6580009.1
• CAZy Family: AA17|AA17
• CAZyme Description: kdtA, waaA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
478		52676.50	9.1990

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiGKB4	19981	N/A	0	19981

• Gene Location: location=JAFJYM010000113:202050-204116(+)

Full Sequence      

MSGATLLAVYHGLWRASMPLVAWYVRRKDLRRLVPTAITAERFGRSAPPAHWDKNGNTAG
RKDDCFTLWIHGASVGECLSALPLVELALGHNLDQAITPSTGEAKRKVRVVLSTTTAAAR
QLLSQRLKENKDAVCVLAPLDHPRCVERFYDAWQPDAGIWIESELWPTLITDAKRRGIRI
GLINGRMSPQSFRLWRMPGLRQFSQSVVGLFSLVLCQDELNRQRFELLGARDAHTALNLK
FASPLSLSDEAEVSTWRRAIGVRPAWVVASTHGGEEVMMAEVHADLSKRVHDSQHLLTVI
IPRHPTRTPAIVKQLHSQFPELSVGLRSRDGLPTNSIDLFIVDTMGETNLVYDAISTAVI
GGTFVKRGGHNPIEPLRAGCHVLTGPHMENFADILLQLKTQYPVSKSLRSVSGLEELAAA
LYSRLKLLDDRPVNGSTSVSSSSHAGHGAELTRAMAELAVSTLSLHELRLISWLANGE

Enzyme Prediction     

No EC number prediction in KAG6580009.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT30	41	242	4.3e-44	0.96045197740113

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235589	PRK05749	1.31e-100	6	430	2	388	3-deoxy-D-manno-octulosonic-acid transferase; Reviewed
224436	KdtA	6.11e-100	6	422	1	381	3-deoxy-D-manno-octulosonic-acid transferase [Cell wall/membrane/envelope biogenesis].
398219	Glycos_transf_N	5.53e-53	41	242	2	175	3-Deoxy-D-manno-octulosonic-acid transferase (kdotransferase). Members of this family transfer activated sugars to a variety of substrates, including glycogen, fructose-6-phosphate and lipopolysaccharides. Members of the family transfer UDP, ADP, GDP or CMP linked sugars. The Glycos_transf_N region is flanked at the N-terminus by a signal peptide and at the C-terminus by Glycos_transf_1 (pfam00534). The eukaryotic glycogen synthases may be distant members of this bacterial family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCQ74891.1|GT30	1.72e-71	6	394	2	356
UEM05359.1|GT30	6.20e-71	6	399	2	361
UEM22691.1|GT30	9.68e-70	6	399	2	361
AZG76195.1|GT30	5.02e-69	5	422	2	379
AMW34117.1|GT30	5.30e-69	68	398	52	364

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XCI_A	1.61e-20	68	417	43	343	Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_B Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_C Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_D Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCU_A Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_B Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_C Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_D Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus]
4BFC_A	1.57e-08	263	395	42	170	Chain A, 3-DEOXY-D-MANNO-OCTULOSONIC-ACID TRANSFERASE [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q1RGU8|KDTA_RICBR	3.14e-45	61	417	44	379	3-deoxy-D-manno-octulosonic acid transferase OS=Rickettsia bellii (strain RML369-C) OX=336407 GN=waaA PE=3 SV=1
sp|Q8VZA5|KDTA_ARATH	4.07e-45	3	429	4	406	Probable 3-deoxy-D-manno-octulosonic acid transferase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=KDTA PE=2 SV=1
sp|Q9ZE58|KDTA_RICPR	2.74e-44	68	394	93	395	3-deoxy-D-manno-octulosonic acid transferase OS=Rickettsia prowazekii (strain Madrid E) OX=272947 GN=waaA PE=3 SV=1
sp|Q4UND5|KDTA_RICFE	2.00e-42	68	394	98	400	3-deoxy-D-manno-octulosonic acid transferase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=waaA PE=3 SV=1
sp|Q68XV7|KDTA_RICTY	2.67e-42	68	394	95	397	3-deoxy-D-manno-octulosonic acid transferase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) OX=257363 GN=waaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999013	0.001001

TMHMM  Annotations     

There is no transmembrane helices in KAG6580009.1.