CAZyme Information: KAG6578052.1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: KAG6578052.1
• CAZy Family: AA17
• CAZyme Description: cytosolic endo-beta-N-acetylglucosaminidase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
916		101111.03	6.1927

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiGKB4	19981	N/A	0	19981

• Gene Location: location=JAFJYM010000118:314173-317067(-)

Full Sequence      

MMSSSSAAPDAAAASAEDPVASTLGADPLFTMEAIATLATLGLGLLYWFCWRPSAAPTPI
STNTSATSSNANAAASTGFTRPREERYAAFVDSEVAANEIVLFVATGDRVGPFRALFDAL
RVKLHVVDLSRTAGGKNVLAALHEKHQEQVDGEQQELLFVRGRLVGGLKHLRALLVGGKK
HELGHECDWGHVRVDEKSDTGFMVLSARNGFQFVRDVGHDTKVAAKLETRPLHTVEELRE
FDTTTLVGCSVPIAPRSRQQRRRSKLLVCHDMKGGYQEDRFKQGCSDFDAYRFYQWDLVD
LFVYFGHALVCPPPTGWIAAGHRHGTRVLGTFLTEGDQGTEFCKELFRDTQSAEAFASKL
AGIAWHGGFDGWLINIENDVPAELVTNIDVFLRTLRKGMQLQNPLAQVVWYGSLSRSGKR
KSFARLDEASVDFFSNVDAFYADYGWVSDDAKFSAAFDLDRRYDVFMGIDVFGRHNMLGG
GKMNCSEPLRLAWNSGVSAALFAPGWTHECYQHEAQEDFVVVENRFWEAVRESWKVRSPC
YDALGGENCLYSSFNIGRGVGAWAKGERISTDTWSNMTELDVQPNQALHVGSIVTTATGS
MKASICHDVAFQGGSSVQLQGQLVGREKSYFKLFDVDIEFSPRRIMELSYTTATREESVC
LLVLTICPGLDRATHYVILRSMDDSGPEAGDNRVDPKKTLSTVAKASLEKHFYLPVSTDF
FDVEAVNAEASLGITADGWCKKTYRLGGQLWDQKHIVEIGMLCTKKLRKVPGEREDYLAY
IGEVCVVGSSGKPLVKAAHRDVHTQPRSCMNATVMSFTRNNANSVSFGVQWELTADGAPV
RYVLVFARTEAGERIFSGKSFDNSLWVDSCAWQQPDIIEGATSSSSHTSTRLTIELQSVS
WAGQSSTVVCQLHLEE

Enzyme Prediction     

EC	3.2.1.96:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH85	272	539	2.5e-65	0.873015873015873

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397623	Glyco_hydro_85	2.90e-96	284	559	1	291	Glycosyl hydrolase family 85. Family of endo-beta-N-acetylglucosaminidases. These enzymes work on a broad spectrum of substrates.
119364	GH85_ENGase	1.04e-88	267	584	1	329	Endo-beta-N-acetylglucosaminidase (ENGase) hydrolyzes the N-N'-diacetylchitobiosyl core of N-glycosylproteins. The beta-1,4-glycosyl bond located between two N-acetylglucosamine residues is hydrolyzed such that N-acetylglucosamine 1 remains with the protein and N-acetylglucosamine 2 forms the reducing end of the released glycan. ENGase is a key enzyme in the processing of free oligosaccharides in the cytosol of eukaryotes. Oligosaccharides formed in the lumen of the endoplasmic reticulum are transported into the cytosol where they are catabolized by cytosolic ENGases and other enzymes, possibly to maximize the reutilization of the component sugars. ENGases have an eight-stranded alpha/beta barrel topology and are classified as a family 85 glycosyl hydrolase (GH85) domain. The GH85 ENGases are sequence-similar to the family 18 glycosyl hydrolases, also known as GH18 chitinases. An ENGase-like protein is also found in bacteria and is included in this alignment model.
227068	COG4724	3.66e-30	283	652	94	479	Endo-beta-N-acetylglucosaminidase D [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHN91514.1|GH85	2.33e-76	220	666	10	448
VDC78376.1|GH85	9.42e-76	263	664	65	454
AEE74996.2|GH85|3.2.1.96	9.62e-76	250	708	54	503
CAG7878887.1|GH85	1.29e-75	263	664	80	469
NP_196165.3|GH85|3.2.1.96	1.87e-75	231	678	25	466

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FHA_A	1.62e-19	283	641	71	441	Chain A, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_B Chain B, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_C Chain C, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_D Chain D, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae]
3FHQ_A	1.62e-19	283	641	71	441	Chain A, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_B Chain B, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_D Chain D, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_F Chain F, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae]
2VTF_A	3.79e-19	283	641	76	446	X-ray crystal structure of the Endo-beta-N-acetylglucosaminidase from Arthrobacter protophormiae E173Q mutant reveals a TIM barrel catalytic domain and two ancillary domains [Glutamicibacter protophormiae],2VTF_B X-ray crystal structure of the Endo-beta-N-acetylglucosaminidase from Arthrobacter protophormiae E173Q mutant reveals a TIM barrel catalytic domain and two ancillary domains [Glutamicibacter protophormiae]
2W91_A	8.59e-15	278	650	70	458	Structure of a Streptococcus pneumoniae family 85 glycoside hydrolase, Endo-D. [Streptococcus pneumoniae TIGR4],2W92_A Structure of a Streptococcus pneumoniae family 85 glycoside hydrolase, Endo-D, in complex with NAG-thiazoline. [Streptococcus pneumoniae TIGR4]
3GDB_A	1.13e-14	278	650	221	609	Crystal structure of Spr0440 glycoside hydrolase domain, Endo-D from Streptococcus pneumoniae R6 [Streptococcus pneumoniae R6]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|F4JZC2|ENAS1_ARATH	3.32e-76	231	678	25	466	Cytosolic endo-beta-N-acetylglucosaminidase 1 OS=Arabidopsis thaliana OX=3702 GN=ENGASE1 PE=1 SV=1
sp|Q9SRL4|ENAS2_ARATH	4.59e-74	250	708	54	525	Cytosolic endo-beta-N-acetylglucosaminidase 2 OS=Arabidopsis thaliana OX=3702 GN=ENGASE2 PE=1 SV=1
sp|P0C7A1|ENASE_CHICK	1.24e-67	249	633	105	474	Cytosolic endo-beta-N-acetylglucosaminidase OS=Gallus gallus OX=9031 GN=ENGASE PE=1 SV=1
sp|Q8BX80|ENASE_MOUSE	9.06e-67	229	650	72	491	Cytosolic endo-beta-N-acetylglucosaminidase OS=Mus musculus OX=10090 GN=Engase PE=1 SV=1
sp|Q8NFI3|ENASE_HUMAN	5.50e-64	232	650	87	499	Cytosolic endo-beta-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=ENGASE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000039	0.000007

TMHMM  Annotations     

There is no transmembrane helices in KAG6578052.1.