CAZyme Information: KAG6576261.1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: KAG6576261.1
• CAZy Family: AA16
• CAZyme Description: Glycosyl hydrolase family 10 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
534	JAFJYM010000124|CGC2	58218.27	10.4407

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiGKB4	19981	N/A	0	19981

• Gene Location: location=JAFJYM010000124:337481-342539(-)

Full Sequence      

MASTAEPRAGIRRLQALKLRLEGDADSSDVMLKSTKQIPDRADKKRKKETPLKGKGPTTK
GNAGGGGSVEPGKERKDADRPANSQRQGIHDAVTATLASSRHRKQILVSNGEPYPGKDRS
MAAAAGDAYTKTTRKKAGVKGLNAVQRRRLHVEMLATETASATLSMKKLEPPVDPAKAKA
TAMRQRRMRKLRARRKATGEGDSFIKSTYSGSKGLNDLAKATGRYMGTATDIGELSDPYY
VKQLKNISDFGMITPGNAMKWDATEPSQNSFSFTKGDQVVALAKASGAKVRCHTLVWHQQ
VPSWVQTLGKAELLKALENHITKVITHFGDSCYAWDVVNEAMGDDGTYRKSFWYTKTGTE
YISTAFKTASAVKKSLGLKTKLYYNDYNTNTINTKSTAVLAMLKSLISAGVEVNGVGFQS
HLSYSDTASASDQISNMRRFEALKLDVALTELDVKTSSTAPSTAEQSKQVTVYKNAVLAC
RKLSKCVGVTIWDFVDTYTWLSSSAPLPWYQPKGKNTPLVRKAAYDGIAAAWQS

Enzyme Prediction     

EC	3.2.1.8:31

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	217	511	6.5e-90	0.9405940594059405

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395262	Glyco_hydro_10	4.21e-118	215	530	1	310	Glycosyl hydrolase family 10.
214750	Glyco_10	1.92e-97	259	528	1	263	Glycosyl hydrolase family 10.
226217	XynA	2.48e-67	227	513	39	331	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOV63055.1|GH10	2.41e-172	203	532	20	350
AOV63054.1|GH10	5.62e-153	197	532	15	348
AOV63057.1|GH10	1.15e-149	204	532	24	353
AOV63056.1|GH10	2.66e-149	197	532	17	357
UIZ24493.1|GH10	2.80e-132	204	532	25	352

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JDT_A	6.07e-97	214	530	2	315	Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDT_B Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDY_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDY_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDZ_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JDZ_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JE0_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE0_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE1_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE1_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE2_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5],6JE2_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5]
5XZO_A	7.74e-90	214	533	2	334	Chain A, Beta-xylanase [Bispora sp. MEY-1],5XZO_B Chain B, Beta-xylanase [Bispora sp. MEY-1],5XZU_A Chain A, Beta-xylanase [Bispora sp. MEY-1],5XZU_B Chain B, Beta-xylanase [Bispora sp. MEY-1]
6Q8M_A	3.00e-87	214	530	24	337	GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8M_B GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8N_A GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872],6Q8N_B GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872]
3WUF_A	6.18e-82	215	531	5	311	The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) from Streptomyces sp. 9 [Streptomyces sp.],3WUG_A The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]
3WUB_A	8.70e-82	215	531	5	311	The wild type crystal structure of b-1,4-Xylanase (XynAS9) from Streptomyces sp. 9 [Streptomyces sp.],3WUE_A The wild type crystal structure of b-1,4-Xylanase (XynAS9) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5ZNB1|XYND_TALFU	3.24e-82	215	534	21	336	Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus OX=28572 GN=xynD PE=1 SV=1
sp|B4XVN1|XYNA_STRSQ	3.78e-79	215	531	43	349	Endo-1,4-beta-xylanase A OS=Streptomyces sp. OX=1931 GN=xynAS9 PE=1 SV=1
sp|O60206|XLNA_AGABI	5.09e-79	215	532	19	331	Endo-1,4-beta-xylanase OS=Agaricus bisporus OX=5341 GN=xlnA PE=2 SV=1
sp|Q9HEZ1|XYNA_PHACH	6.10e-79	215	529	94	403	Endo-1,4-beta-xylanase A OS=Phanerodontia chrysosporium OX=2822231 GN=xynA PE=1 SV=1
sp|B7SIW2|XYNC_PHACH	5.57e-77	210	534	79	399	Endo-1,4-beta-xylanase C OS=Phanerodontia chrysosporium OX=2822231 GN=xynC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KAG6576261.1.