CAZyme Information: KAG6574461.1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: KAG6574461.1
• CAZy Family: AA1
• CAZyme Description: Glycosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
523		59808.75	9.1544

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiGKB4	19981	N/A	0	19981

Full Sequence      

MSLLTRALLLLLSLWASAQAAASADAVAVQEQKQDPPTSRFAYVTVHYEGTSRDAEYVLG
VQVLMHSIKMTGSPYDLVVLASDSVSERSKALFRSMGCRVLDVTNINNPFLGGTLRNKNF
IYTLNKLHVWNLLEYERVVYLDADNVLIRNADELFLCGEFCAVFMNPCHFHTGLLVVTPS
ATEYQRLLNALGHLESFDGADQGFLSSMYSKMLRKAKLFTPMKASYTGAELEGLKKSEPE
PKGMRLPVGYNINHKYFYEQYHWKLFYLRHFASMTSPISPVKVVVESARGIPALTVGYPM
APVLKPWYWWAGFFMDLHAVWHDIRATLPASQEHYGAEEAVKTLLGFFSSLALLTAALYA
LKITMPMRQIQQRCTDLAMRNSKHTRYAFMAFRMALVVFAFRISPARVHPLAPVNYGYGL
MIFMNVFLHIYFACVISNFWDPHQEVSMPPVLYVTRFWFYVALIVASELFVVSFSTWSVF
PNVLWRLFSLFWSIFLCAYWQVTYYRLALNAEFGGKKERLRSL

Enzyme Prediction     

No EC number prediction in KAG6574461.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	54	271	6.4e-28	0.8132295719844358

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	1.16e-52	41	328	1	240	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
215090	PLN00176	4.39e-11	37	226	19	234	galactinol synthase
133064	GT8_GNT1	6.73e-10	41	191	1	150	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.
133037	GT8_A4GalT_like	8.44e-07	54	155	8	116	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
227884	Gnt1	1.94e-06	56	171	70	209	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ21271.1|GT8	UIZ21271.1|GT8	0.0	33	523	29	519
CCA16211.1|GT8	CCA16211.1|GT8	4.78e-184	39	523	45	516
CBD34299.1|GT8	CBD34299.1|GT8	2.67e-56	40	341	42	305
ACL54522.1|GT8	ACL54522.1|GT8	2.38e-55	36	325	45	301
QCD81290.1|GT8	QCD81290.1|GT8	4.23e-55	33	341	40	310

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EQJ_A	6EQJ_A	5.04e-17	42	210	6	173	Crystal Structure of Human Glycogenin-1 (GYG1) Tyr195pIPhe mutant, apo form [Homo sapiens],6EQL_A Crystal Structure of Human Glycogenin-1 (GYG1) Tyr195pIPhe mutant complexed with manganese and UDP [Homo sapiens],6EQL_B Crystal Structure of Human Glycogenin-1 (GYG1) Tyr195pIPhe mutant complexed with manganese and UDP [Homo sapiens]
3Q4S_A	3Q4S_A	5.04e-17	42	210	6	173	Crystal Structure of Human Glycogenin-1 (GYG1), apo form [Homo sapiens],3QVB_A Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese and UDP [Homo sapiens],3U2W_A Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese and glucose or a glucal species [Homo sapiens],3U2W_B Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese and glucose or a glucal species [Homo sapiens]
3T7M_A	3T7M_A	5.04e-17	42	210	6	173	Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese and UDP, in a triclinic closed form [Homo sapiens],3T7M_B Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese and UDP, in a triclinic closed form [Homo sapiens],3T7N_A Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese and UDP, in a monoclinic closed form [Homo sapiens],3T7N_B Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese and UDP, in a monoclinic closed form [Homo sapiens],3T7O_A Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese, UDP-Glucose and glucose [Homo sapiens],3T7O_B Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese, UDP-Glucose and glucose [Homo sapiens],3U2U_A Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese, UDP and maltotetraose [Homo sapiens],3U2U_B Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese, UDP and maltotetraose [Homo sapiens],3U2V_A Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese, UDP and maltohexaose [Homo sapiens],3U2V_B Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese, UDP and maltohexaose [Homo sapiens],3U2X_A Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese, UDP and 1'-deoxyglucose [Homo sapiens],3U2X_B Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese, UDP and 1'-deoxyglucose [Homo sapiens]
3U2T_A	3U2T_A	6.97e-17	42	210	27	194	Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese [Homo sapiens]
3RMV_A	3RMV_A	3.08e-16	42	210	6	173	Crystal Structure of Human Glycogenin-1 (GYG1) T83M mutant complexed with manganese and UDP [Homo sapiens],3RMW_A Crystal Structure of Human Glycogenin-1 (GYG1) T83M mutant complexed with manganese and UDP-glucose [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8VZP6|GUX8_ARATH	sp|Q8VZP6|GUX8_ARATH	1.06e-51	37	411	59	392	Putative glucuronosyltransferase PGSIP8 OS=Arabidopsis thaliana OX=3702 GN=PGSIP8 PE=2 SV=1
sp|F4JMI5|GUX7_ARATH	sp|F4JMI5|GUX7_ARATH	7.15e-51	34	411	52	389	Putative glucuronosyltransferase PGSIP7 OS=Arabidopsis thaliana OX=3702 GN=PGSIP7 PE=3 SV=1
sp|Q8GWB7|GUX6_ARATH	sp|Q8GWB7|GUX6_ARATH	9.81e-33	38	328	28	278	Inositol phosphorylceramide glucuronosyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=IPUT1 PE=1 SV=1
sp|Q8W4A7|GUX3_ARATH	sp|Q8W4A7|GUX3_ARATH	4.19e-22	57	254	297	490	Putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 3 OS=Arabidopsis thaliana OX=3702 GN=GUX3 PE=2 SV=1
sp|Q9LSB1|GUX1_ARATH	sp|Q9LSB1|GUX1_ARATH	1.45e-21	34	254	311	527	UDP-glucuronate:xylan alpha-glucuronosyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=GUX1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000301	0.999669	CS pos: 20-21. Pr: 0.9783

TMHMM  Annotations     

Start	End
344	366
387	404
414	436
457	479
483	505