CAZyme Information: KAG6572815.1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: KAG6572815.1
• CAZy Family: AA1
• CAZyme Description: Carbohydrate-binding domain, family 9

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
383	JAFJYM010000129|CGC1	44625.51	4.8364

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiGKB4	19981	N/A	0	19981

Full Sequence      

MHPHRYAAYHLPPATDQLATSITVDGVLDEKEWSEVPWSEPFQDIQGPHFWSQPWFATKF
KLRYDQQFLYVGAYLEETEVWANVSKRNEVIFHDNDFEVFVDADGSTHNYKEFELNARNA
TWNLWLNRPYRDGGHENSTRVDPHYGFDMLNSGMRSAVFVKGDINDPAERLHYWTTEIAL
PLSELALHSNAQVPPAANSFWRINFSRVEWSVRVVTDKQTGKQHYEKKPGFKEENWVWSA
QNAVDMHRPEWWGYLQFRPRDENPPALVYDRWTMDEVVPVDPEWGVRYVSFQYYYAQHAY
RAATGTYTTSLEQLLPYFSSREAIECTKLIDISITNNSFSAQIGLREKYSGFGDNPQYVA
NIEDDGHIDVEKVELASPIAAIM

Enzyme Prediction     

No EC number prediction in KAG6572815.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM9	24	219	1.4e-29	0.8461538461538461

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
187678	CBM9_like_3	6.37e-53	24	254	1	200	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily may co-occur with various other domains.
187676	CBM9_like_2	1.95e-14	17	208	6	170	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized subfamily are typically found at the N-terminus of longer proteins that lack additional annotation with domain footprints.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCM88676.1|CBM9	BCM88676.1|CBM9	4.04e-64	3	314	5	280
QOT09656.1|CBM0	QOT09656.1|CBM0	6.37e-64	22	347	27	334
QXD16319.1|CBM9	QXD16319.1|CBM9	1.92e-62	3	260	32	272
UII25170.1|CBM0	UII25170.1|CBM0	2.02e-62	21	277	39	283
QLG44757.1|CBM0	QLG44757.1|CBM0	2.82e-62	21	270	42	290

PDB Hits     

KAG6572815.1 has no PDB hit.

Swiss-Prot Hits     

KAG6572815.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999707	0.000326

TMHMM  Annotations     

There is no transmembrane helices in KAG6572815.1.