CAZyme Information: KAG5520207.1

Basic Information

• Species: Pneumocystis sp. 'macacae'
• Lineage: Ascomycota; Pneumocystidomycetes; ; Pneumocystidaceae; Pneumocystis; Pneumocystis sp. 'macacae'
• CAZyme ID: KAG5520207.1
• CAZy Family: GT66
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1094		125933.81	9.4871

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PmacacaeP2C	3427	N/A	37	3390

• Gene Location: location=CM030733:510811-516050(-)

Full Sequence      

MTQKTEKGLCEILYSCVHMVLDSTYGIFIIGGLLRIFFLIYGHWHDSRSPVKYTDIDYKV
FTGAAEYAYHGKSVYDRETYRYTPLLAWMLIPNVMGVPYFGKIVFSVFDLISGYLIRNIL
LFQGNSVKKINLYTIIWLWNPIVIVISTRGNAESIIGTGVLLCLWMALLRRPFITGCLLG
LVIHFKLYAIIYIPTFLWVMDNKYEGKSFSKTVFYWITYSRIYFTIAIVLTSIILNGIMY
QIYGMPFLNHTYFYHFIRIDHRHNFSPYHLWLYYLSSPIKSSFHIPISFISFIPQMLLSM
CLIPIALAKKNLFGSIFSQTFAFVTFNKVCTSQYFMWYIVLLPILLPFLDPFSSLIMLFL
WGFGQATWLFFAYCLEFLGINFLYSRYVFSGPSTLRNKERIGPFTWKAGVLFVITGAGLV
WYFKNEKEKMLQRRYLNQNKSIGKAKIGGPFELIDHEGKNVTDKDFLGKYILIYFGFTRC
PDICPEELDKMADIINRVNNKKNVLTPIFITCDPNRDTPSQIKEYLREFHPKIIGLTGTY
ESIKAVCKAYRVYFSTPPNIKPGDDYLDAKAAQVISSECKQTNVSEISENLTPNQYFELR
SRVINALRKSKNPDPYPHKFHVNIELPEFIRTYSSLKRGEVNRDIIVCVSGRIRNKRESG
SKLRFYDLYSNGVKVQIMAQAQDCDKDYLKMHEYIQRGDIVGVIGYPGRTMPKGKGKDEG
EGGELSVFCKEIILLSPCLRMLPMERHGLTNQETRYRQRYLDLIVNKSTRDKFVLRSKCI
HCGKVETPMMNLIAGGANAKPFITHHNELDLNLYLRVAPELYLKMLVVGGLNRVYEIGKQ
FRNEGIDLTHNPEFTSCEFYCAYADIYDLMDMTEEMLSSMVYKLTGSYQIKYHPNGPEGD
ELCISFSKPWRRIEIIPYLEQRLSVAFPPADQLHTEQTNQFLKDLCQKNNIDCPPPTTNS
RLLDKVDPLPTKHTNPAAYRRVPRAPLSQPDIPDRPSSSHVSPRKAPQIQAWALRKIRSL
HGLQRDPLTPAERSCRAARKIRGTGQAEGPGRRRGPDGRRELLHRTVPLPAPLYISLTSK
GNMPCLPPAAGAWA

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	146	383	4.8e-72	0.9122137404580153

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215278	PLN02502	4.08e-163	569	966	34	423	lysyl-tRNA synthetase
224111	LysU	3.39e-125	585	974	2	380	Lysyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis].
173607	PTZ00417	3.79e-125	557	966	39	454	lysine-tRNA ligase; Provisional
234778	lysS	6.01e-124	594	966	4	361	lysyl-tRNA synthetase; Reviewed
273107	lysS_bact	8.39e-120	593	996	2	396	lysyl-tRNA synthetase, eukaryotic and non-spirochete bacterial. This model represents the lysyl-tRNA synthetases that are class II amino-acyl tRNA synthetases. It includes all eukaryotic and most bacterial examples of the enzyme, but not archaeal or spirochete forms. [Protein synthesis, tRNA aminoacylation]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSL64979.1|GT50	1.42e-159	56	412	23	361
UKZ90890.1|GT50	8.30e-99	27	381	15	377
UKZ48798.1|GT50	2.26e-97	27	379	15	375
UKZ75326.1|GT50	6.53e-96	27	379	15	356
QYS97269.1|GT50	3.72e-91	27	381	15	404

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7F6W_A	9.39e-151	590	966	3	387	Chain A, Lysine--tRNA ligase [Saccharomyces cerevisiae]
5HGQ_A	5.85e-134	593	966	7	382	Loa loa Lysyl-tRNA synthetase in complex with Cladosporin. [Loa loa],5HGQ_B Loa loa Lysyl-tRNA synthetase in complex with Cladosporin. [Loa loa],5HGQ_C Loa loa Lysyl-tRNA synthetase in complex with Cladosporin. [Loa loa],5HGQ_D Loa loa Lysyl-tRNA synthetase in complex with Cladosporin. [Loa loa]
6CHD_A	7.58e-134	570	966	50	447	Crystal Structure of Human Lysyl-tRNA Synthetase complexed with L-Lysylsulfamoyl Adenosine [Homo sapiens],6CHD_B Crystal Structure of Human Lysyl-tRNA Synthetase complexed with L-Lysylsulfamoyl Adenosine [Homo sapiens]
4DPG_A	8.08e-134	590	966	2	379	Crystal Structure of Human LysRS: P38/AIMP2 Complex I [Homo sapiens],4DPG_B Crystal Structure of Human LysRS: P38/AIMP2 Complex I [Homo sapiens],4DPG_C Crystal Structure of Human LysRS: P38/AIMP2 Complex I [Homo sapiens],4DPG_D Crystal Structure of Human LysRS: P38/AIMP2 Complex I [Homo sapiens],4DPG_E Crystal Structure of Human LysRS: P38/AIMP2 Complex I [Homo sapiens],4DPG_F Crystal Structure of Human LysRS: P38/AIMP2 Complex I [Homo sapiens],4DPG_G Crystal Structure of Human LysRS: P38/AIMP2 Complex I [Homo sapiens],4DPG_H Crystal Structure of Human LysRS: P38/AIMP2 Complex I [Homo sapiens],4YCU_A Crystal structure of cladosporin in complex with human lysyl-tRNA synthetase [Homo sapiens],4YCU_B Crystal structure of cladosporin in complex with human lysyl-tRNA synthetase [Homo sapiens],6ILD_A Crystal Structure of Human LysRS: P38/AIMP2 Complex II [Homo sapiens],6ILD_B Crystal Structure of Human LysRS: P38/AIMP2 Complex II [Homo sapiens]
3BJU_A	1.04e-133	590	966	2	379	Chain A, Lysyl-tRNA synthetase [Homo sapiens],3BJU_B Chain B, Lysyl-tRNA synthetase [Homo sapiens],3BJU_C Chain C, Lysyl-tRNA synthetase [Homo sapiens],3BJU_D Chain D, Lysyl-tRNA synthetase [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UUE6|SYKC_SCHPO	4.07e-162	585	966	64	451	Lysine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=krs1 PE=3 SV=1
sp|P15180|SYKC_YEAST	2.15e-149	585	966	62	451	Lysine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KRS1 PE=1 SV=2
sp|A0A120HYZ1|CLA4_CLACD	8.18e-136	570	966	43	442	Lysine--tRNA ligase cla4 OS=Cladosporium cladosporioides OX=29917 GN=cla4 PE=2 SV=1
sp|P37879|SYK_CRIGR	4.85e-135	571	966	51	447	Lysine--tRNA ligase OS=Cricetulus griseus OX=10029 GN=KARS1 PE=1 SV=1
sp|Q99MN1|SYK_MOUSE	1.87e-133	589	966	67	445	Lysine--tRNA ligase OS=Mus musculus OX=10090 GN=Kars1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000042	0.000002

TMHMM  Annotations     

Start	End
20	42
94	116
129	148
152	169
176	198
213	235
242	259
285	307
334	356
366	388
401	423