CAZyme Information: KAG5519850.1

Basic Information

• Species: Pneumocystis sp. 'macacae'
• Lineage: Ascomycota; Pneumocystidomycetes; ; Pneumocystidaceae; Pneumocystis; Pneumocystis sp. 'macacae'
• CAZyme ID: KAG5519850.1
• CAZy Family: GT48
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
2674	CM030720|CGC2	307730.33	6.8701

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PmacacaeP2C	3427	N/A	37	3390

Full Sequence      

MKQPVKTHKNGKESSKGLLGSSTFNISKQNNSDVSKFKFGAFGSIRERIFSSVMIESLEF
DGLSPDLVVIFKNISKKDTTTKLKALDDISTWIDDNPGKLNENNFLEIWSYLYPRLTIDA
DRQVRLSCHHVHHKIYNESGKRIAKFVKKIIGSWIASTFDNDRAVKKAAIESFNTVFKTS
EKRLTVKKVYHKYILNFNKNVILKELPSTLSDLRYVSQEISEVRYFKIISSILASLSDII
LNLKLEEIKEEEDSYIEIVSSETFWQFLYQSDSDVRKYFYELIKNISNKWPELLMSQKNM
IKKSITKLMENADHLFISVTLSTMEVFYLVCPEIWEHDFFGDYQTFSYFKKLILNNNFNS
EQFWIYFYDLIIKIPLNPHKNNFKIYLNDFIDIIWEGVHKKTKNNIESAFEVFFKIICFY
GKCFKNMDDIFSILEKKVSDIFKLYFNDFTSLGTKISDENFRHALIKGFLRNEYISNDLF
NKFWYDSKKYIEKILSDTSIIYKENCDKLLIVGIRWINVADEFIREMKENVKNVKNDNLS
DGKYLIFQIICEITYLIILYIRQHDDLCDKTLKLLDYILSKFTDIVFEDCRIVLELETFI
MEKIPKFITSLTKSMMSIFLIYITENKNIENLKLLWISLFSHLSTIENKSKENIFVYEIA
QMIIDNKIDMKKLKGRLPQIDLIDHVLLNSVHLNIKDIFENWESLNNLFAIKEIIFSKEV
IIESLLCLTEKVFFSNDSEFHSNIYDVKILTLLYKVLNDSFDLYLCFLQNVRAIEFHIKM
WNFSQIEKENISENIVLFNDMFEQVYCLSNKVGSDLRFNIANIIQKQILSLSSLDFLLMT
SLHNLSIKILFYVSEVEKANLLNIFLFTSHEWNAAFTYLIFKYPNKNLELFNSLKICCLI
FSNFIQTKKDIKVGNISDLLRMTVFSEMIIYSLMLKSCILEIHWLILYGIMVCGELVRDN
FELEHANCLWKSITEEQEDKLFALINRSKDLFFNILSSKKIKILGIDDVVEQNDIKFLKK
VKERSIGKSPETYYSACVLFRILQFLIEKNYYNQKEAEIWLNDINIENEQNIFIIAAIVN
GFQEKLFFSKKLENIRDRICSDLSGKLVVDQDLKKLILFNIFIPFDDTLWRHLPQQRIET
KIKNQPLLICTQLLSEILTQIPLNIIEKQLLYPHLLSQSRCTQIVTFDWLTNWISKNQED
LILDTEFSKINADLPSELLSMVLSPPYCYNLLNDIGHKNNMFCEIRCFFLSWILIFIHFK
NTSFILKSSYIENLKNNNCISIAIELIFKILELLNNRFMNSIEILRDISKWKNIDDIKTE
ILSLATYVYLLILKHVPSIARDWWISCKNRQLTQLVETFTEKYISPILIEEEINLVLLEF
TQLKITDNNIHVKISKTTREVTTFYTIDDQYLEMIIRLPSCYPLSQVIVEGLQKIGIKDA
QWRAWLLASRILVTTQNGSIVDAVNLFKRNVSLHFEGVAECNICFSILSVQDRSLPSKKC
ATCKNKFHSGCLYKWFKTSNASKCPLYVFLVIWTNFLIAFFLKIFVWVSLLVGSNAYPLS
IIRRGSRSIHNEGLSHSGNSQKGCLFPFNNFELSAVTSDNGKLGWATGLGDICSAGSYCS
YYCRSGYHARLNSRILGLSSSFSEGRLFCDGSGNLQMPSESLCVRASHSVYLLNLFDVSL
SFCERIFSNGGLRLASNSVNGRSFSELTIPYESSGPSSSFYYLGPPGTGRDGCTMGNRFS
NQGLWSPYTLGISKDYKGDIHLTLGWNPTYIGDSYWSGVTPNWGIRIDCEGFGCGSKSCF
IDPSVHGINECENPVNSYSSAAFCAVRISLNTRTRVVLFSRSNVNDELKVLSSLPHFDFQ
DSSETKLVPGTVDVSESKHEESKSIVDKVEITEHHESNDKVEDDTDAQVTVLNKQEAEES
THTVDKNSDSEHSKTSELDSFDNKKSTFTDLLSKVDISSVTSLGQSSFGSNGYIFGNDGL
TLMLFQLHGNKNNHIHTSGASCPLSIHDNSNSLSVSSPHSVSDDCAPTNALLFLDRHVSD
GYKLLADKFDNYLTKISSLIRNGDFQVLELDTPRNNNESDSVNNGTQHESSAYIMKNNIL
WTSIEMYLLGHEVRNDITDVHYFKTISNRQSFAIVYISVFVMTYCISLESQTTSNLIVPA
TSYFGKNSLIPLINTINGVLYAVVKQQMAKLGVIFGRIEGFCFSLLLYDMGCMMYMMSTN
IVTFIISSILHTIGSTGIQILQQIIISDMSNFLNRGLLNSILDIPLLINVWVGPSLAQNI
YLPEPASEQWRLGYGIWAVVLSIGSLPVIIVLYLGQFRSEGIRMLSLENNDGSITFSMKR
IFIELDLVGIMILSFGLIMLLFQLIHEFPIFYDVKSLYIITIFVIVTILCVIFPLWECFY
AKYPIFDITSFKLGMIGSGYFSSFFYFMGFYLYNNYFSTYLYVTKSNSIKRVGYLNNVFS
FTSTIVAIFVGIFVKYNKRYNFFIYIGSPIYMIGIVYMIYNLRVDESVIEMTISQAIIGI
SGGIYNMSALIGIQTVSCRQQVVVNTTLFLTLASLGGAIGSAISGIMWSSLLPKMLKIYS
ERLNIFLTSSDYTLIIGSPFILDQYPKFVKGTLGRMAIILAYNDLMKVLYISSAMCTIPM
LFCVMFMKDIHLNRIKQEVYNDNVYKFSDELKKH

Enzyme Prediction     

No EC number prediction in KAG5519850.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH132	1602	1830	9.6e-29	0.7491749174917491

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340880	MFS_ARN_like	9.02e-108	2132	2649	1	513	Yeast ARN family of Siderophore iron transporters and similar proteins of the Major Facilitator Superfamily. The ARN family of siderophore iron transporters includes ARN1 (or ferrichrome permease), ARN2 (or triacetylfusarinine C transporter 1 or TAF1), ARN3 (or siderophore iron transporter 1 or SIT1 or ferrioxamine B permease) and ARN4 (or Enterobactin permease or ENB1). They specifically recognize siderophore-iron chelates are expressed under conditions of iron deprivation. They facilitate the uptake of both hydroxamate- and catecholate-type siderophores. This group also includes glutathione exchanger 1 (Gex1p) and Gex2p, which are proton/glutathione antiporters that import glutathione from the vacuole and exports it through the plasma membrane. The ARN family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.
227544	COG5219	2.68e-84	25	1526	7	1517	Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only].
397780	SUN	2.17e-30	1595	1805	17	233	Beta-glucosidase (SUN family). Members of this family include Nca3, Sun4 and Sim1. This is a family of yeast proteins, involved in a diverse set of functions (DNA replication, aging, mitochondrial biogenesis and cell septation). BGLA from Candida wickerhamii has been characterized as a Beta-glucosidase EC:3.2.1.21.
319405	RING-CH-C4HC3_LTN1	1.05e-24	1480	1526	2	48	RING-CH finger, H2 subclass (C4HC3-type), found in E3 ubiquitin-protein ligase listerin and similar proteins. Listerin, also known as RING finger protein 160 or zinc finger protein 294, is the mammalian homolog of yeast Ltn1. It is widely expressed in all tissues, but motor and sensory neurons and neuronal processes in the brainstem and spinal cord are primarily affected in the mutant. Listerin is required for embryonic development and plays an important role in neurodegeneration. It also functions as a critical E3 ligase involving quality control of nonstop proteins. It mediates ubiquitylation of aberrant proteins that become stalled on ribosomes during translation. Ltn1 works with several cofactors to form a large ribosomal subunit-associated quality control complex (RQC), whick mediates the ubiquitylation and extraction of ribosome-stalled nascent polypeptide chains for proteasomal degradation. It appears to first associate with nascent chain-stalled 60S subunits together with two proteins of unknown function, Tae2 and Rqc1. Listerin contains a long stretch of HEAT (Huntingtin, Elongation factor 3, PR65/A subunit of protein phosphatase 2A, and TOR) or ARM (Armadillo) repeats in the N terminus and middle region, and a catalytic RING-CH finger, also known as vRING or RINGv, with an unusual arrangement of zinc-coordinating residues in the C-terminus . Its cysteines and histidines are arranged in the sequence as C4HC3-type, rather than the C3H2C3-type in canonical RING-H2 finger.
341045	MFS_Azr1_MDR_like	3.78e-14	2398	2563	151	315	Saccharomyces cerevisiae Azole resistance protein 1 (Azr1p), and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This subfamily is composed of multidrug resistance (MDR) transporters including various Saccharomyces cerevisiae proteins such as azole resistance protein 1 (Azr1p), vacuolar basic amino acid transporter 1 (Vba1p), vacuolar basic amino acid transporter 5 (Vba5p), and Sge1p (also known as Nor1p, 10-N-nonyl acridine orange resistance protein, and crystal violet resistance protein). MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. This subfamily belongs to the Methylenomycin A resistance protein (also called MMR peptide) and similar multidrug resistance (MDR) transporters (MMR-like MDR transporter) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFZ39256.1|GH132	QFZ39256.1|GH132	5.64e-35	1584	1840	23	282
QFZ27107.1|GH132	QFZ27107.1|GH132	5.64e-35	1584	1840	23	282
QFZ50615.1|GH132	QFZ50615.1|GH132	5.64e-35	1584	1840	23	282
QFZ44938.1|GH132	QFZ44938.1|GH132	5.64e-35	1584	1840	23	282
QFZ33585.1|GH132	QFZ33585.1|GH132	5.64e-35	1584	1840	23	282

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3J92_0	3J92_0	6.55e-52	59	1526	56	1760	Structure and assembly pathway of the ribosome quality control complex [Homo sapiens],3J92_w Structure and assembly pathway of the ribosome quality control complex [Homo sapiens],3J92_z Structure and assembly pathway of the ribosome quality control complex [Homo sapiens]
5FG0_A	5FG0_A	1.63e-23	51	351	11	324	Structure of the conserved yeast listerin (Ltn1) N-terminal domain, MONOCLINIC FORM [Saccharomyces cerevisiae S288C],5FG0_B Structure of the conserved yeast listerin (Ltn1) N-terminal domain, MONOCLINIC FORM [Saccharomyces cerevisiae S288C]
5FG1_A	5FG1_A	5.26e-23	51	351	11	324	Structure of the conserved yeast listerin (Ltn1) selenomethionine-substituted N-terminal domain, TRIGONAL FORM [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WHE1|MIRC_ASPFU	sp|Q4WHE1|MIRC_ASPFU	1.57e-78	2130	2664	68	595	MFS siderochrome iron transporter C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mirC PE=2 SV=2
sp|Q870L3|MIRC_EMENI	sp|Q870L3|MIRC_EMENI	3.99e-77	2130	2663	65	591	Siderophore iron transporter mirC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mirC PE=3 SV=1
sp|O74349|LTN1_SCHPO	sp|O74349|LTN1_SCHPO	9.24e-66	52	1526	38	1602	E3 ubiquitin-protein ligase listerin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rkr1 PE=3 SV=1
sp|O74395|STR1_SCHPO	sp|O74395|STR1_SCHPO	1.30e-61	2117	2661	78	606	Siderophore iron transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=str1 PE=1 SV=1
sp|Q04781|LTN1_YEAST	sp|Q04781|LTN1_YEAST	2.36e-60	51	1526	21	1553	E3 ubiquitin-protein ligase listerin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RKR1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000065	0.000001

TMHMM  Annotations     

Start	End
1248	1270
1526	1548
2213	2235
2256	2278
2293	2315
2341	2363
2378	2400
2413	2432
2452	2474
2481	2501
2511	2533
2546	2568
2628	2647