CAZyme Information: KAG5519519.1

Basic Information

• Species: Pneumocystis sp. 'macacae'
• Lineage: Ascomycota; Pneumocystidomycetes; ; Pneumocystidaceae; Pneumocystis; Pneumocystis sp. 'macacae'
• CAZyme ID: KAG5519519.1
• CAZy Family: GT4
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
859	CM030721|CGC1	97974.64	7.7985

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PmacacaeP2C	3427	N/A	37	3390

• Gene Location: location=CM030721:55589-58569(-)

Full Sequence      

MELYLLTQHTWIHLYTAITLISISYIWALPVINLNNDTYFTNNTLYTQDIIATHYKTPYT
LALLVLIADLLKKIFDIIDTTYISNSNSCNPTFYKPNVTKETQTNNTFDHRKSTITLKAN
STAVNTTTKNTLHGEKTTLTATKTMPDEHSTIYPHIYKSINVLEPIVTRPPLSTFMNATH
PLQPKSIYGKDLTKPIHTNKFYSNFFLGTQAFPTYLDPYVVTWISGIYSGLTVSHTDDNQ
KVFSSDNPPSYFLSPLGIYSVVFSAQELNDGTLTLTSLDQMSVNAIITPKNCTEKKIEFP
LVRGEAYITAIYSDLTPVFTSVVGFKHIEKADIKNHEYFKFILTLYDGKRWLLYAFPKTK
TSFNLKIQDNMLKATTGIFSGTIQVAKVPINNFDAENILDASAGTYPRKVILSAFVNGKT
GNYKYTFDIFKYKNRTLLHYAMHHHISSFDNITASKKTCVSLPSTTNGLMVAYTGDCWNM
IEKDLPTDIDFFPYSFGKKPEYSDEALKAIEEAAKYEVSQNFDSQIDKNTIYFSGKVFSK
LALLCLVINNILKNETLSQECLEKFNKSYMPFVKNMNEYKLVYDTTWKGIVTNQGFTKGP
YVDFGASYYNDHHFHYGYMVFAAAVIGYINSSWIKENKDWIIDLIRDVANPVSDSYFPAF
RSFDWFTGHSWAKGIFESPDGKDEESSSEDYNFYFAMKLFGMVTGDNAMISRANLMLAIL
KRSLHSYFLYESTNTIMPKVFLPNFVAGIKFMNKIHHTTYFSPRTECIQGIHMLPLTPIS
AYIRTKSFVQSEWDNKLTSIIDTINDGWKGILYANLAISDPEKSYTFFSSNFDRKYLDNG
SSLAWYLVYSSAFANSTKS

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	183	849	1.5e-206	0.9887459807073955

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	0.0	165	856	58	758	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	0.0	502	847	2	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	3.62e-106	180	495	1	320	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIU47332.1|GH81	0.0	70	859	1	788
AIU47333.1|GH81	0.0	70	859	1	788
AIU47331.1|GH81	0.0	160	856	90	785
AIU47330.1|GH81	0.0	160	856	90	785
QSL66570.1|GH81	0.0	160	856	52	762

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	1.40e-103	165	825	11	694	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	2.50e-103	165	825	36	719	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	5.57e-101	165	825	11	694	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	4.50e-20	583	821	393	627	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	1.44e-19	610	822	439	652	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	5.35e-191	160	856	1	705	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	5.98e-170	161	851	192	900	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	7.21e-170	158	851	43	735	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q12168|ENG2_YEAST	6.40e-155	171	854	87	779	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|P53753|ENG1_YEAST	3.81e-140	160	856	400	1115	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000028	0.000000

TMHMM  Annotations     

Start	End
12	34