CAZyme Information: KAG5518112.1

Basic Information

• Species: Pneumocystis sp. 'macacae'
• Lineage: Ascomycota; Pneumocystidomycetes; ; Pneumocystidaceae; Pneumocystis; Pneumocystis sp. 'macacae'
• CAZyme ID: KAG5518112.1
• CAZy Family: GH76
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1524	CM030728|CGC1	179541.33	6.3018

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PmacacaeP2C	3427	N/A	37	3390

• Gene Location: location=CM030728:236370-241736(+)

Full Sequence      

MIFRTKNIVFIFFGGIFFKIISGSPIINTYLTASFNVPPFVNLFLETVASQNESLFFPLL
DAISKEKYMMLSKLNFNNYNYLRNLVYDYGIIKDNISLSILDYALALQSSAPKIHAYYNY
YNDVIVSEMINRNFTLECKNWILFNERQYCDIDEFLKSMDIENGNFKPVTLLSFDHIFDN
DKNSDSPLAILYADLSSDNYVTYHSFLYKKAKSGDLKYVFRHKPGHFNSNDSLYLSGYGV
EASLKRTDYLVMDDRKIIEDMYEKMAPQSYSSEFNSNFFSLNIQENEIKLLTNAELKELG
FSVTQFVMESKAPLETLNYILQDFPKYASYLSTIKINKKTLKMLTLNYKYFNPGETLFFI
NGLEISPDNINGFSLLKYLRKEYDLILSLQNLGLSLEKAKSLITDKAIFDLFNMVLNVRF
DFRDTYNGGNVILWLNDIENDPIYMHFSDDIYQYLDELPSGELHTIRRNLHHVIIPLDFS
KRFDMIFFRDIFFFIQRLFPIRFGILPVWQDPKDIFLVKIFYYLFTTYGINSAIEYMLFL
DLDSRHNETVLSRNYKFILFKYDQDIKMEDLDINNIMKSKKIEQYILRTKEWSSRLNIEN
DDFLIVNGKFLEKKQNWGDLLFDTFMTDINVIRKKIVEKSLTNNINILDCLLEDAIYRRD
SYIHPVGKIIKSLNLNDYIFDQKNAKFSSINENLNTELSLWLIADFDTKKGLEFAKFALE
YIIEHPYTSLRFLHNPKLTNKSNFDCFSSFLFLLNEKNIDITESTLDYIQKLLNNYNSNV
TVNKEVEYPYFILNMYNSSELLSSSIKAKLYWEKMKDQLDKLEFLPGEFGLLANGYVIGP
LLESYDFLLDSFKLLGEFHHFSVISKLKTITKRLNIKNSRHKMFFPVLYSIILSYIVSEK
HDFSYFLQFGRNKIYTLTQKLTPSLTFGDQKNSAFEIKVVLDPLNEISQKLVPVLKVLEQ
IEGVYLELYLNPLQQISKLPINRFYRYVLQSSDLIYPNAIFERLPISNLYTINYDFPGSW
IVTQKRSIYDLDNLLLSDLFSRKIKEIVVIYELKYILIEGHAEEIGLKTPPSGIQLALKT
KNNIFVTDTIVMSNLGYFQFKANPGVFKIDVITKENHDIFEISKISDKFGFNSDNFKKEI
ILESFEGLTIYTKFIRYPRKDKVLNLEELDKFHKSNDFELENITSKFMQSQHSSGSTTDT
SAKKSHAEINIFSIASGHLYERFLYIMILSVLKHTKYTVKVWFIENFLSSSFKNFLPYIA
NEFGFQYELITYRWPYWLRSQKEKQRQIWGYKILFLDVLFPLELNNIIFVDADQIIRTDL
KELVDMDLQNAPYGYTPMCDSRKEMEDYRFWKKGYWKSHLKGKPYHISALYVVDLKKFRE
IAAGDILRQHYQILSQDPESLSNLDQDLPNNLQDVLPIFSLPQNWLWCKTWCSDESLKDA
KTIDLCNNPMTKESKLERARNQVPEWNEYDKTVANLIERILKEKRNNETTEFNADNIAMP
VDVMENIQFNSDEKNKKKSIHDEF

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1209	1456	3.3e-127	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408203	Glyco_transf_24	0.0	1209	1476	1	268	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
133054	GT8_HUGT1_C_like	3.18e-163	1209	1456	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
132996	Glyco_transf_8	1.72e-53	1209	1449	1	241	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
408201	Thioredoxin_14	6.16e-45	420	663	1	248	Thioredoxin-like domain. This is the third out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
408199	Thioredoxin_12	2.46e-44	38	224	2	178	Thioredoxin-like domain. This is one of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSL64450.1|GT24	0.0	15	1523	19	1354
BCR85402.1|GT24	4.60e-301	20	1491	24	1463
QRD91624.1|GT24	2.60e-298	20	1491	24	1470
QMW47293.1|GT24	2.60e-298	20	1491	24	1470
QMW35231.1|GT24	2.60e-298	20	1491	24	1470

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MU1_A	3.87e-281	21	1484	5	1455	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5NV4_A	3.87e-281	21	1484	5	1455	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TRT_A	1.65e-279	21	1484	5	1455	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS8_A	1.91e-241	24	1418	1	1382	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS8_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	1.27e-222	21	1484	5	1221	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09140|UGGG_SCHPO	1.08e-245	27	1491	22	1446	UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpt1 PE=1 SV=2
sp|Q9NYU1|UGGG2_HUMAN	1.49e-207	21	1485	29	1507	UDP-glucose:glycoprotein glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=UGGT2 PE=1 SV=4
sp|Q09332|UGGG_DROME	1.48e-197	27	1480	30	1511	UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=Uggt PE=1 SV=2
sp|Q6P5E4|UGGG1_MOUSE	1.16e-196	99	1476	116	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4
sp|Q9NYU2|UGGG1_HUMAN	2.46e-196	99	1484	116	1531	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.795445	0.204563

TMHMM  Annotations     

Start	End
7	29