CAZyme Information: KAG5439792.1

Basic Information

• Species: Pneumocystis canis
• Lineage: Ascomycota; Pneumocystidomycetes; ; Pneumocystidaceae; Pneumocystis; Pneumocystis canis
• CAZyme ID: KAG5439792.1
• CAZy Family: GT59
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
735	JACEFK010000002|CGC4	86704.95	9.2989

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcanisCanA	3113	N/A	38	3075

• Gene Location: location=JACEFK010000002:148935-151743(-)

Full Sequence      

MELKYRNREKKNEEILRIPEKTEKIEEEDVKFKVISRNILCIVIFILSILTRFYYIKHPS
EVVFDEVHFGKFLSLYLKRSYFFDVHPPFTKLLYAFFGWIIGYDGHFLFEKIGDSYIKNQ
VPYILLRSLPALLGSMVVPLVFLIMKDSGHSLLSSTLAASFVLFDNAQVAQSRLILLDSI
FIFLMTSSIYCYIRFSKLKYCRFSLNWWKWLILTGIFLSCTISTKYVGLFTYITIGTMIA
LELWDILDIRKGYSMHYFMENFLAKIFCLIIFPFILYLFWFYIHFAVLSKTGPGDKFMSP
SFQETLEGNILSTSSIQVNYYDKILIMHKETDAYLHSCNARYPLRYDDGRISSQGQLVTA
SKEIDENNYWIILPAYPNFTEPQLGKPVLNNDYIRLKHVSTGTYLLTHDVASPRYPTNQE
FVTVSEELKNRYNETIFQIKLEYHADTHSLKTKGGRFKLIHNLTGVAMWSDIDPLPDWAL
NQQEINGNKRLKEERNIWLVDDIVDISNTDRKINSNSTSKGLSFFQKYIELQFSMFDHNS
RLKASHPFSSYPLEWPLLNRGISFWIDSSKYQQIYLLGNPVGWWFEISFLVIFVIAVISD
QILLRRGMMFIRESRELFYTYTTFFFLFWLTHYFPFFLMNRKLFLHHYLPAHIASSLLTG
STFQKNRNKIDIELKKMNNPKKARVMFILLMCSLIGSFIFFSPFTYGNPGLTSDKLYQRK
WSPNWDFAFLKHKPE

Enzyme Prediction     

EC	2.4.1.109:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	43	285	1.8e-64	0.9955156950672646

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224839	PMT1	0.0	31	731	17	699	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
396786	PMT	1.20e-68	42	289	1	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
406576	PMT_4TMC	1.11e-64	526	721	1	196	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
397103	MIR	1.05e-09	336	494	13	181	MIR domain. The MIR (protein mannosyltransferase, IP3R and RyR) domain is a domain that may have a ligand transferase function.
197746	MIR	1.42e-06	318	375	4	57	Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSL64374.1|GT39	0.0	20	727	13	757
VBB72720.1|GT39	3.66e-247	33	731	42	772
CDP23606.1|GT39	3.79e-247	33	731	43	773
CAP69590.1|GT39	3.79e-247	33	731	43	773
AEO54171.1|GT39	3.74e-245	20	731	42	775

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_A	7.57e-82	39	727	53	729	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P25_B	8.50e-75	47	728	74	754	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
3MAL_A	2.53e-07	316	499	16	185	Crystal structure of the SDF2-like protein from Arabidopsis thaliana [Arabidopsis thaliana],3MAL_B Crystal structure of the SDF2-like protein from Arabidopsis thaliana [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O42933|PMT4_SCHPO	2.49e-217	42	731	63	776	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm4 PE=3 SV=1
sp|Q59X23|PMT4_CANAL	1.52e-204	46	721	56	746	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT4 PE=2 SV=2
sp|P46971|PMT4_YEAST	3.12e-200	43	721	58	753	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT4 PE=1 SV=1
sp|F1QF89|POMT1_DANRE	2.10e-104	38	731	15	719	Protein O-mannosyl-transferase 1 OS=Danio rerio OX=7955 GN=pomt1 PE=1 SV=1
sp|Q9W5D4|POMT2_DROME	8.86e-95	39	727	41	765	Protein O-mannosyl-transferase 2 OS=Drosophila melanogaster OX=7227 GN=tw PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999986	0.000015

TMHMM  Annotations     

Start	End
34	56
81	103
123	145
174	196
203	222
227	246
266	288
582	604
617	639
644	663
685	707