CAZyme Information: KAG5439587.1

Basic Information

• Species: Pneumocystis canis
• Lineage: Ascomycota; Pneumocystidomycetes; ; Pneumocystidaceae; Pneumocystis; Pneumocystis canis
• CAZyme ID: KAG5439587.1
• CAZy Family: GT57
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1072	JACEFK010000003|CGC1	120074.81	6.2565

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcanisCanA	3113	N/A	38	3075

• Gene Location: location=JACEFK010000003:483028-487597(-)

Full Sequence      

MKARVMKEKMLENNLKGRNPCSCKDDCICFFKDIEAAFFTNSQDEFCNAYPSGPVTEVNS
YAKRGYSLDEYPYNNKQCEFPSDPTLSSVNLDGKKQGWANPSGNDCSPGKHCLYLCQSGY
GVSSRGLTSLEYHSNGFPFGKILCRDDGSIDKGSEEPLCIPDPGNVILLNLFDTPHSFCQ
RIYSPTNVILGSNSVDSLSHRVLNVPFQVNGRSSSFFYMNPPGTPLEAGCTGINSLTNRG
PCSPYVLDVSKDYRGTTHVKVGWNPFYINDQYWGRTPPNWGLKLLCQGGDCDKPSCSIDP
TKHNVNECENCDHLYLGASFCSISVSAGSRVVVVLFSGSNSDREQELLQKLPPLPTDNSD
DSDDSSPGERLITKNKKSSYLEKNGLSYSEFEGDKHSDTIEDKDSDLTLKLKLYNEGSKD
DIELGNEGLPIDGDDKEDNKQISSELDKKLLFKDPLSRMSFYDLTKTKSSADDITHKSSS
KNNAMTLMFFEIHGKDKQMGSSDISCSLSGPDSLNPVGSVSSNTVDKISYNCEPTRMVLF
IDKKITNGYKLIAEKFDSYATKISSLIQNNEFQTIEYNDYDESEGTCLLYKKNKDNVEAV
NIISKTWNKQSLTIVYISIFIMTYCISLESQTTSNFIVPATSYFGKNSLIPLINTINGIL
YAVMKQQMGKVGIIFRRTEGFYMSNFLNRGLLNSILDVPFLINVWVGPSLAQSIYLPALD
KEQWRLGYGIWAIVLSVGSLPIITVLYLDRFKTNEMDILSLKNNKDELINLSVKKFFVEC
DFVGIVLLFLGLILLLFQLIHEFPVFYNIKSLYIATIFIITVILCVIFPLWEFYYAEYPI
FNAKSFNLRTIESGTYLYVTKSNSIKRVGYLNNVFSFTSTIVAIFVSILIKYNKRCNIFV
YIGPFIYVFGIIYMIYNLRVDESIIEMTISQAMIGIGGGFYNMSALIGVQASSNRRQAVV
NTALFLTLASIGGAVGSAISGIVWSNLLPKMLDFYSKRLNLFLTSNDYSMIIGSPLILDQ
YPKFIKGTIGRIVIILAYNDVMKLLYICSAMCVVPMLFCVIFIKDIHLNKAN

Enzyme Prediction     

No EC number prediction in KAG5439587.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH132	75	334	1.6e-30	0.834983498349835

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340880	MFS_ARN_like	3.88e-76	612	1065	1	513	Yeast ARN family of Siderophore iron transporters and similar proteins of the Major Facilitator Superfamily. The ARN family of siderophore iron transporters includes ARN1 (or ferrichrome permease), ARN2 (or triacetylfusarinine C transporter 1 or TAF1), ARN3 (or siderophore iron transporter 1 or SIT1 or ferrioxamine B permease) and ARN4 (or Enterobactin permease or ENB1). They specifically recognize siderophore-iron chelates are expressed under conditions of iron deprivation. They facilitate the uptake of both hydroxamate- and catecholate-type siderophores. This group also includes glutathione exchanger 1 (Gex1p) and Gex2p, which are proton/glutathione antiporters that import glutathione from the vacuole and exports it through the plasma membrane. The ARN family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.
341045	MFS_Azr1_MDR_like	3.60e-08	875	979	216	315	Saccharomyces cerevisiae Azole resistance protein 1 (Azr1p), and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This subfamily is composed of multidrug resistance (MDR) transporters including various Saccharomyces cerevisiae proteins such as azole resistance protein 1 (Azr1p), vacuolar basic amino acid transporter 1 (Vba1p), vacuolar basic amino acid transporter 5 (Vba5p), and Sge1p (also known as Nor1p, 10-N-nonyl acridine orange resistance protein, and crystal violet resistance protein). MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. This subfamily belongs to the Methylenomycin A resistance protein (also called MMR peptide) and similar multidrug resistance (MDR) transporters (MMR-like MDR transporter) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.
340879	MFS_MMR_MDR_like	2.55e-06	870	1018	194	354	Methylenomycin A resistance protein (also called MMR peptide) and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of bacterial, fungal, and archaeal multidrug resistance (MDR) transporters including several proteins from Bacilli such as methylenomycin A resistance protein (also called MMR peptide), tetracycline resistance protein (TetB), and lincomycin resistance protein LmrB, as well as fungal proteins such as vacuolar basic amino acid transporters, which are involved in the transport into vacuoles of the basic amino acids histidine, lysine, and arginine in Saccharomyces cerevisiae, and aminotriazole/azole resistance proteins. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. For example, MMR confers resistance to the epoxide antibiotic methylenomycin while TetB resistance to tetracycline by an active tetracycline efflux. MMR-like MDR transporters belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.
349949	MFS	3.94e-06	868	988	33	148	Major Facilitator Superfamily. The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3-phosphate transporter), LacY (lactose permease), and EmrD (multidrug transporter), MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement. Bacterial members function primarily for nutrient uptake, and as drug-efflux pumps to confer antibiotic resistance. Some MFS proteins have medical significance in humans such as the glucose transporter Glut4, which is impaired in type II diabetes, and glucose-6-phosphate transporter (G6PT), which causes glycogen storage disease when mutated.
340883	MFS_MdtG_SLC18_like	1.52e-05	813	984	200	348	bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily of transporters. This family is composed of eukaryotic solute carrier 18 (SLC18) family transporters and related bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as multidrug resistance protein MdtG, from Bacillus subtilis such as multidrug resistance proteins 1 (Bmr1) and 2 (Bmr2), and from Staphylococcus aureus such as quinolone resistance protein NorA. The family also includes Escherichia coli arabinose efflux transporters YfcJ and YhhS. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The SLC18 transporter family includes vesicular monoamine transporters (VAT1 and VAT2), vesicular acetylcholine transporter (VAChT), and SLC18B1, which is proposed to be a vesicular polyamine transporter (VPAT). The MdtG/SLC18 family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSL65200.1|GH132	2.12e-42	105	342	61	295
CAG98185.1|GH132	1.77e-37	78	346	59	332
QEU59177.1|GH132	1.77e-37	78	346	59	332
QFZ39256.1|GH132	1.99e-37	78	337	23	282
QFZ27107.1|GH132	1.99e-37	78	337	23	282

PDB Hits     

KAG5439587.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WHE1|MIRC_ASPFU	7.87e-59	583	1072	41	587	MFS siderochrome iron transporter C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mirC PE=2 SV=2
sp|Q870L3|MIRC_EMENI	1.14e-57	597	1072	55	584	Siderophore iron transporter mirC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mirC PE=3 SV=1
sp|O94607|STR2_SCHPO	1.84e-44	595	1072	48	587	Siderophore iron transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=str2 PE=1 SV=1
sp|O74851|ADG3_SCHPO	9.04e-31	77	337	72	337	Probable secreted beta-glucosidase adg3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=adg3 PE=2 SV=1
sp|Q04018|YM79_YEAST	3.17e-28	70	347	43	331	Uncharacterized protein YMR244W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YMR244W PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000065	0.000001

TMHMM  Annotations     

Start	End
697	719
726	748
783	805
812	834
868	890
897	916
927	949
962	984
1041	1063