CAZyme Information: KAG5439050.1

Basic Information

• Species: Pneumocystis canis
• Lineage: Ascomycota; Pneumocystidomycetes; ; Pneumocystidaceae; Pneumocystis; Pneumocystis canis
• CAZyme ID: KAG5439050.1
• CAZy Family: GT4
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380	JACEFK010000005|CGC1	44870.93	9.6457

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcanisCanA	3113	N/A	38	3075

• Gene Location: location=JACEFK010000005:462074-463400(-)

Full Sequence      

MKLIELLILTISFLGYKVILVLICTLSSFLNVYDTSTSLILKQPKNILQKIIASLTRWDN
IYYITLARRGLLFEQEWAFGPAFPYLIRLFTDKVFSNKSLYNYAFTSIIISHLFHFFSIF
FLYYLTFKIYHSRDMAIVSSLLYLISPSGIFLSAGYTESFFSFITFLGFIFFENDYNFLA
ALVWCIASIIRSNGLFLKSSQIIGIGFFWIQYRAYVEFCWPQKQRNWCFKRLPLIYSFVQ
NYYWNVGPFRYFTVSQIPNFILASPAVYISIKSGVYYFSKNRNQFQEVTWKLNPYYIAQL
FLTIMCVCVMHVQIFTRMISCLPGIYWWLANCLLNDQLYSDSDKTSLNKRVRKKSLYWVK
IWVSYELVQAVLFGAFLPPA

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	18	380	2.4e-88	0.972972972972973

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	1.63e-38	19	380	13	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	2.31e-22	7	380	20	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSL65897.1|GT76	3.58e-141	1	380	1	302
CAA90590.2|GT76	3.03e-49	10	380	81	464
UPK97415.1|GT76	3.74e-46	9	380	14	420
VBB80094.1|GT76	1.19e-45	12	380	44	461
QMW44188.1|GT76	1.46e-45	33	380	35	472

PDB Hits     

KAG5439050.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09712|GPI18_SCHPO	5.38e-50	10	380	81	464	GPI mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpi18 PE=3 SV=2
sp|Q6C216|GPI18_YARLI	1.41e-43	33	380	29	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1
sp|Q2GSI6|GPI18_CHAGB	7.13e-42	12	380	25	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q4I0K3|GPI18_GIBZE	3.05e-41	33	380	38	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q2UJS7|GPI18_ASPOR	1.40e-38	55	380	78	434	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.917627	0.082373

TMHMM  Annotations     

Start	End
7	29
103	125
137	156
166	188
195	212
257	279
292	314
318	335
356	378