CAZyme Information: KAG5438821.1

Basic Information

• Species: Pneumocystis canis
• Lineage: Ascomycota; Pneumocystidomycetes; ; Pneumocystidaceae; Pneumocystis; Pneumocystis canis
• CAZyme ID: KAG5438821.1
• CAZy Family: GT39
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
403	JACEFK010000006|CGC2	47487.55	9.6503

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcanisCanA	3113	N/A	38	3075

• Gene Location: location=JACEFK010000006:373666-375016(-)

Full Sequence      

MLYLRTFFNHNRYIFIISGLFRLFLLIYGHWHDLRSPVKYTDMDYFVFTGAAEKTYHKQS
VYDRETYRYTPLLAWMLIPNVIGIPYFGKILFSICDLIAGYLMKNILILQGYSAKKANLY
IATWLWNPIVAVISTRGNAESMIGTGVLLCLWMILLKRPFFTGCLLGLVIHLKLYTVIYI
PTFLWVMDNHYEGNLSPKTIFRWITHSRIYFTLALILVSILLNGIMYQIYGMTFLNQTYF
YHFIRTDHRHNFSPYHLWLYYTSSSVESFFHIPISLVSFIPQMLLSTCLIPVAFAKKNLP
GSIFSQTFAFVTFNKVCTSQYFMWYLILLPIFLPSLKFHSGLLMIILWGLAQALWLFFAF
RLEFLGMNVFFPYLWISSILFFVINIWILGHIIDSLSFSYKPN

Enzyme Prediction     

No EC number prediction in KAG5438821.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	133	393	5.2e-83	0.9961832061068703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	2.49e-83	12	399	9	421	GPI mannosyltransferase
252941	Mannosyl_trans	1.76e-61	133	393	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSL64979.1|GT50	8.53e-184	43	397	23	377
UKZ90890.1|GT50	1.38e-111	14	394	15	403
UKZ48798.1|GT50	2.22e-110	14	394	15	403
UKZ75326.1|GT50	5.53e-109	14	394	15	384
VBB81264.1|GT50	3.33e-108	6	393	26	439

PDB Hits     

KAG5438821.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4I073|GPI14_GIBZE	4.06e-104	14	394	13	406	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1
sp|Q7S4Z3|GPI14_NEUCR	1.45e-103	4	393	19	482	GPI mannosyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gim-1 PE=3 SV=1
sp|Q4WAH2|GPI14_ASPFU	1.61e-101	22	399	19	424	GPI mannosyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi14 PE=3 SV=1
sp|Q2TXB8|GPI14_ASPOR	6.04e-99	22	397	19	411	GPI mannosyltransferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi14 PE=3 SV=2
sp|Q5B7W0|GPI14_EMENI	2.00e-98	15	393	9	425	GPI mannosyltransferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gpi14 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999646	0.000385

TMHMM  Annotations     

Start	End
13	32
72	94
137	156
166	188
209	231
268	290
310	332
342	364
371	393