CAZyme Information: KAG5437789.1

Basic Information

• Species: Pneumocystis canis
• Lineage: Ascomycota; Pneumocystidomycetes; ; Pneumocystidaceae; Pneumocystis; Pneumocystis canis
• CAZyme ID: KAG5437789.1
• CAZy Family: GH76
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
783	JACEFK010000011|CGC2	91860.41	7.8427

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcanisCanA	3113	N/A	38	3075

• Gene Location: location=JACEFK010000011:166638-169594(+)

Full Sequence      

MKNDIFIWILLLGQWIAIFANKNETYWLIKQTEIASNASLLWGPYRPNLYMGIRSRDPKS
ILAGVMWTGLNNYAQIQELRHTCEQNDDIEMYGWQEFDLRTGGRHIIKDKKMDVEIEIEF
AKIYTEKQAGNWGLRIKGKPKKANGKTSVFFYIASNEDEIKLDSKLEKEGIKGNVFFTSQ
NSKKITIEITQGPDTNVYPSFDHSISKEKHLNRTMYLSMMVPHKNIWMAKDLLLSALSKS
VNNYYEKYSENIPPPSLFYTLPNIGGQGNLHFIQKIFQGPFEFNILYSSLNNSITSHQLE
NKIISNSKLFQKRFGKTFPFTAPFNSNKYTNFSQSLLSNLLGNIGYFYGDSVVDRSHIYG
YDETFQEYNSQDFIQLEGPFSLFTATPNKSFFPRGFYWDEGFHLLLIGHWDNDLSLEIIK
SWISLMDSDGWIAREQILGDEARSKVPKEFIIQYPHYANPPTMVLPILSFIEKLDQHNKS
KTDYAEETIYSRYIKYPELAINFLKKHYHLFRRQYDWYRRTQQGEIEEWNRKAFSSKEGY
RWRGCTFKHCLTSGLDDYPRPFPHNGELHLDLLSWIGLFTKALRQIAEKINYKKDVEEYI
SIENAIIKNIEDLHWSHTYNAYCDCTVDENHTSIHECHIGYVTIFPLLTGLLPASSPHLG
KLLDIMYSPEHLWSPYGLRSLSTKDPYFEKDENYWRGAIWININYMALSSLYKNYINTPG
LYQNKAKKIYNELRINLVNTVFREWERTHFVWEQYNQTSGIGQRTKGFTGWTSLIVNILS
EKY

Enzyme Prediction     

EC	3.2.1.106:25	3.2.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	567	780	9.1e-28	0.43333333333333335

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397353	Glyco_hydro_63	0.0	294	781	1	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
407154	Glyco_hydro_63N	4.95e-90	40	254	1	221	Glycosyl hydrolase family 63 N-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the N-terminal beta sandwich domain.
225942	GDB1	8.49e-08	331	752	206	588	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSL65479.1|GH63	0.0	2	775	5	774
QRD84190.1|GH63	1.21e-256	23	780	23	802
UDD57712.1|GH63	1.21e-256	23	780	23	802
QMW44709.1|GH63	2.06e-255	23	780	23	814
QMW32679.1|GH63	2.06e-255	23	780	23	814

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4J5T_A	2.45e-166	36	781	11	802	Crystal structure of Processing alpha-Glucosidase I [Saccharomyces cerevisiae S288C]
5MHF_A	1.00e-119	40	783	37	779	Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_B Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_C Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_D Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14255|GCS1_SCHPO	1.17e-219	29	783	31	808	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1
sp|P53008|CWH41_YEAST	2.39e-165	36	781	41	832	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1
sp|Q80UM7|MOGS_MOUSE	1.13e-121	40	783	92	834	Mannosyl-oligosaccharide glucosidase OS=Mus musculus OX=10090 GN=Mogs PE=1 SV=1
sp|O88941|MOGS_RAT	1.78e-119	42	783	94	834	Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus OX=10116 GN=Mogs PE=1 SV=1
sp|Q13724|MOGS_HUMAN	1.15e-116	40	783	94	837	Mannosyl-oligosaccharide glucosidase OS=Homo sapiens OX=9606 GN=MOGS PE=1 SV=5

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.012470	0.987486	CS pos: 20-21. Pr: 0.9392

TMHMM  Annotations     

There is no transmembrane helices in KAG5437789.1.