CAZyme Information: KAG5436854.1

Basic Information

• Species: Pneumocystis canis
• Lineage: Ascomycota; Pneumocystidomycetes; ; Pneumocystidaceae; Pneumocystis; Pneumocystis canis
• CAZyme ID: KAG5436854.1
• CAZy Family: AA2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
281	JACEFK010000020|CGC1	32467.09	5.2061

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcanisCanA	3113	N/A	38	3075

• Gene Location: location=JACEFK010000020:11840-12897(-)

Full Sequence      

MEEGPIKRCWVTLLSDLGEKNGYLNGVLTLHYTLKKVKTRYPLFVIYTDKCTADALSVLE
KAGIKTKYVKTLHPAVVQDYGVDTQKFNECFNKLNVFGLFEYERVVFVDSDMIFMKNADE
LFDIHLNKGFIASAHACVCNPPQQNMHTDSPISCTFGIRMLNSGLVVLNPNPEEFALILE
HVVNSDKYPATMLNFAEQSLLSYVYEEKWLPLPYIYNALKTLRTVHDKLWNDDDVKIVHY
ILNKPWSDENEGRDSDDPTHAWWWSLEKERKAEEMNSVVNE

Enzyme Prediction     

No EC number prediction in KAG5436854.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	21	248	3.8e-41	0.8443579766536965

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	1.76e-60	10	270	3	240	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
215090	PLN00176	8.22e-17	5	263	20	288	galactinol synthase
133037	GT8_A4GalT_like	1.46e-12	101	248	95	248	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
279798	Glyco_transf_8	2.17e-12	23	248	10	250	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
227884	Gnt1	8.11e-09	77	246	143	351	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSL65903.1|GT8	1.39e-148	1	279	34	330
CAE7032945.1|GT8	1.18e-68	4	281	11	313
QRD04613.1|GT8	9.45e-67	7	281	13	309
BCR87299.1|GT8	1.07e-65	4	281	6	304
QSS57188.1|GT8	3.61e-62	2	279	14	316

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MW5_A	2.27e-16	1	271	1	260	UDP-galactose:glucoside-Skp1 alpha-D-galactosyltransferase with bound UDP and Platinum [Globisporangium ultimum],6MW8_A UDP-galactose:glucoside-Skp1 alpha-D-galactosyltransferase with bound UDP and Manganese [Globisporangium ultimum]
4UEG_A	4.40e-06	23	247	15	221	Crystal structure of human glycogenin-2 catalytic domain [Homo sapiens],4UEG_B Crystal structure of human glycogenin-2 catalytic domain [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9FXB2|GOLS2_ARATH	3.07e-21	4	281	18	305	Galactinol synthase 2 OS=Arabidopsis thaliana OX=3702 GN=GOLS2 PE=1 SV=1
sp|Q4PSY4|GOLS7_ARATH	5.29e-20	2	266	14	288	Galactinol synthase 7 OS=Arabidopsis thaliana OX=3702 GN=GOLS7 PE=2 SV=1
sp|O22693|GOLS4_ARATH	7.46e-20	3	263	18	289	Galactinol synthase 4 OS=Arabidopsis thaliana OX=3702 GN=GOLS4 PE=2 SV=1
sp|Q947G8|GOLS1_SOLLC	2.21e-19	10	266	22	277	Galactinol synthase 1 OS=Solanum lycopersicum OX=4081 GN=GOLS1 PE=2 SV=1
sp|Q9FFA1|GOLS5_ARATH	2.64e-19	6	281	20	305	Galactinol synthase 5 OS=Arabidopsis thaliana OX=3702 GN=GOLS5 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000090	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KAG5436854.1.