CAZyme Information: KAG5422000.1

Basic Information

• Species: Candida metapsilosis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida metapsilosis
• CAZyme ID: KAG5422000.1
• CAZy Family: GT71
• CAZyme Description: TPS2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
879		99691.30	6.6607

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CmetapsilosisBP57	5743	N/A	17	5726

• Gene Location: location=JAEOAQ010000001:2407518-2410157(-)

Full Sequence      

MPELSQLKVSPANIHAVSPKDYANNDKVKLSGRILNVSTTLPTQIVSNYDSKTNLYYWDV
DIVHGSSALFSSQSFLQQHTDWETHVIAWTGELKNKVKNTVNVTADNLEDDPLYLDDEDK
EEIEKKLQKAIGSENIGPIWLLRRDQERWRRYAESVIWPVFHYFSGVPSDGKEEIQAWHD
YVKFNEAYANKIKQIYKPGDVIWIHDYYLLLLPQLLRMEFPDAYIGHFLHTPFPSSEYFR
CLSKRSQLLDGLLGADKIGFQSESFQRHFVSCCARVLGCEVTKNQIFAYGTTISAETLPI
GIDTLRIEQDAFSKSSGIDQKVEAIRKLYKDKKIIVGRDRLDRVRGVVQKLEAFQMFLEM
YPQWRDKVVLIQVSTPGYSHSANVEQKATELINQINSRYGTLNHTPVLHYQMRVPKEEYL
ALLRVADLCLITSVRDGMNTTAFEFVICQKYNNSPLILSEFTGTASVLNSAILVNPWDSV
GVSKTINDALSFTNEEKEVLESTLYKKVVSNTVQNWTSTFIRDIIDHSVVTHSSHYTPAL
NRPLLLRNYSHSKRRLFLFDYDGTLTPIVKDPAAAIPSDKLNRVLDILASDPKNQIWIIS
GRDQAFLEKWMGKKHVGLSAEHGCFIKDLGSKEWVNLAEAYDMSWQPKVEDVFKKYTKQT
PGSNIEIKKVALTWHYRGADPELGAYQAQKCLDELNETIATEYDVEVMSGKANIEVRPKF
LNKGEIVRRLVTHPHGTKQSLEEESRDEVCHEKLPDFVLCLGDDLTDEDMFKSLHKIENQ
WKLDNVPTNQFGTYGVFPVAVGPASKKTVATAHLTEPAQVLETLGLLAGTVSLFESAGSV
DLDDRGHVANSASSMKSKDAIHQASLRKKRSIELGNAAK

Enzyme Prediction     

EC	3.1.3.12:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	22	524	3.1e-158	0.9894736842105263

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
184712	PRK14501	0.0	79	828	38	724	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
340820	GT20_TPS	0.0	33	524	1	462	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
395781	Glyco_transf_20	3.41e-170	32	524	1	468	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
223457	OtsA	1.09e-152	119	524	70	477	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].
215555	PLN03063	8.53e-130	33	771	12	717	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCG22685.1|GT20	0.0	1	878	1	878
CCE40834.1|GT20	0.0	1	874	1	874
CAX44578.1|GT20	0.0	6	873	5	875
AOW26019.1|GT20	0.0	6	873	5	875
CAC17748.1|GT20|3.1.3.12	0.0	6	873	5	875

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DXF_A	7.26e-294	6	534	5	533	Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314],5DXF_B Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314]
5DXI_A	1.19e-165	533	832	1	302	Structure of C. albicans Trehalose-6-phosphate phosphatase C-terminal domain [Candida albicans SC5314],5DXI_B Structure of C. albicans Trehalose-6-phosphate phosphatase C-terminal domain [Candida albicans SC5314]
5DXN_A	3.44e-97	537	827	3	269	Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 2 [Aspergillus fumigatus Af293],5DXO_A Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 3 [Aspergillus fumigatus Af293],5DXO_B Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 3 [Aspergillus fumigatus Af293]
5DXL_A	4.27e-93	537	827	3	269	Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 1 [Aspergillus fumigatus Af293]
5HUV_A	2.61e-86	152	524	92	467	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P31688|TPS2_YEAST	0.0	23	858	5	877	Trehalose-phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS2 PE=1 SV=3
sp|Q9P4D3|TPS2_ZYGRO	4.40e-311	33	873	10	899	Trehalose-phosphatase OS=Zygosaccharomyces rouxii OX=4956 GN=TPS2 PE=1 SV=1
sp|P78875|TPP1_SCHPO	3.11e-208	30	828	35	813	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tpp1 PE=1 SV=2
sp|O14145|TPS2_SCHPO	5.88e-158	152	824	172	846	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tps2 PE=3 SV=1
sp|Q54NU9|TPSB_DICDI	5.18e-148	121	777	108	753	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] B OS=Dictyostelium discoideum OX=44689 GN=tpsB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999641	0.000404

TMHMM  Annotations     

There is no transmembrane helices in KAG5422000.1.