CAZyme Information: KAG5421492.1

Basic Information

• Species: Candida metapsilosis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida metapsilosis
• CAZyme ID: KAG5421492.1
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1364	JAEOAQ010000001|CGC8	157064.94	4.8372

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CmetapsilosisBP57	5743	N/A	17	5726

• Gene Location: location=JAEOAQ010000001:1343208-1348200(+)

Full Sequence      

MPGLTAEEERLKDIKYRQWGPYVSERSWGTVREDYSSDGNAWDSFKFEDYARVSRWSQDG
LAGVSDRRQLVNITMALWNGKDDILKEKLYGLTNNQGNHGEDVKELYYYLDNTPSHSYMK
YLYKYPQNKFPYEELKEENAKRSRLEQEYEITDTGLFDNNEYFDVVFECAKDSPDDLYFR
ITAYNRSDKPAPLHLLPNVVLRNTWAWGTKESINEPKPHVKQVNDYTIEVETHKFGKRYL
SFAPSAGIHDDSPDVEPRLVFTDNETNFKKLYGQENKHKFVKDGFHELVVRGDEKAVNPD
KEGTQAAAWYVFDQDGGVPPGDYVTIRYKFTKDNSDVDEYKLDQIFSKRQNEADQFYWKV
SPLPISDELRQIQRYAFAGLLWSKQFYHFVHNYWAYGDPNTVKPPVNRANGRNKEWKHLY
IDDILSLPDKWEYPFFAAWDTAFHCIPFAMIDPWFAKNQIDLLLREWYMHPNGQIPAYEW
NFSDVNPPVHAWAAYRIFKIERKMYGREDIDFLERVFQKLMLNFAWWVNRKDAEGNNIFE
GGFLGLDNIGVFNRSEALPTGGNLEQADSTGWMAFFSLQMLNIALELAKTRPVYENIASK
FFEHFVVIADALTFRGGEGDNESSTKNSLWDEEDEFYYDAIRYGDHNTQSLPVRSLVGLI
PLYASLTLEPELLEKFPSFKKRLDWFVHHRKEVAERTIASMETRGVGERLLLALVSKERL
VAILRRMLDETEFLSPYGIRSLSKYHKEHPFSMEVNGETFKVEYLPGESDSGMFGGNSNW
RGPIWFPTNFLLVEALQRFYLYYGPDLKVECPTGSGEYLNLAQCAQEIQHRLIHLFLPDE
DGNRACNGDDELVNKDPFFKDYVPFYEYFDGDTGRGLGASHQCGWTAVVAKWIHDNGVTC
RIPKTPRTPVNRRNSSVLLHDSASTDEDVKKYRPKSGPFSGKLVRRKSGKSLLNLTVNAL
DLNDDEEEATTKAAVCTQFDGLDHGVCVTDEILKKELTELQKTQSGASIDSGDEVDDEFL
EQVKAAFKKYKSRTDDDDNVSGDEFETRLHDNNTTINRGKQQRMSDSFNTYENDFQFALQ
EAKAKTSQIESVQGEQRQTYLKAIEAAADEALEALDQMTIEVQNLPTTQRSSYNTKIRQY
KSQIDEVKDKYKKLSDSQDKHELFGSRYRDNDDEGADGVSNSQRKQLLNNQSSLERSSQR
LQDSHRIALETENIGGNILNDLRSQREQIGGARDTLMQADSYVDRSISTLKKLHITFITK
DGNQYTYEVAEGDNILDIAQAHNLDMEGACGGSCACSTCHIIVDPEFYDEIPEPSDDEND
MLDLAFGLTETSRLGCQVKMSKELDGIRVALPAMTRNLQNKDFN

Enzyme Prediction     

No EC number prediction in KAG5421492.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	436	889	8.7e-19	0.35789473684210527

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178203	PLN02593	1.00e-52	1255	1357	3	106	adrenodoxin-like ferredoxin protein
131062	fdx_isc	1.39e-25	1266	1357	17	105	ferredoxin, 2Fe-2S type, ISC system. This family consists of proteobacterial ferredoxins associated with and essential to the ISC system of 2Fe-2S cluster assembly. This family is closely related to (but excludes) eukaryotic (mitochondrial) adrenodoxins, which are ferredoxins involved in electron transfer to P450 cytochromes. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other]
223706	Fdx	4.01e-25	1255	1355	4	102	Ferredoxin [Energy production and conversion].
277215	SNARE_Vti1	2.27e-22	1193	1252	3	62	SNARE motif of Vti1. Vti1 (vesicle transport through interaction with t-SNAREs homolog 1) belongs to the Qb subgroup of SNAREs (soluble N-ethylmaleimide-sensitive factor attachment protein receptor). Vti1b interacts with syntaxin 7 (Qa), syntaxin 8 (Qc), and the lysosomal R-SNARE VAMP8 or VAMP7 to form the endosomal SNARE core complex that mediates transport from the early endosomes and the MVBs (multivesicular bodies), and from the MVBs to the lysosomes, respectively. Vti1a interacts with syntaxin 16 (Qa), syntaxin 6 (Qc), and the lysosomal R-SNARE VAMP4 to form an endosomal SNARE core complex that mediates transport from the early endosomes to the TGN (trans-Golgi network). SNARE proteins consist of coiled-coil helices (called SNARE motifs) which mediate the interactions between SNARE proteins, and a transmembrane domain. The SNARE complex mediates membrane fusion, important for trafficking of newly synthesized proteins, recycling of pre-existing proteins and organelle formation. SNARE proteins are classified into four groups, Qa-, Qb-, Qc- and R-SNAREs, depending on whether the residue in the hydrophilic center layer of the four-helical bundle is a glutamine (Q) or arginine (R). Qa-, as well as Qb- and Qc-SNAREs, are localized to target organelle membranes, while R-SNARE is localized to vesicle membranes. They form unique complexes consisting of one member of each subgroup, that mediate fusion between a specific type of vesicles and their target organelle. Their SNARE motifs form twisted and parallel heterotetrameric helix bundles. Examples for members of the Qb SNAREs are N-terminal domains of SNAP23 and SNAP25, Vti1, Sec20 and GS27.
185668	PTZ00490	1.27e-20	1248	1358	31	142	Ferredoxin superfamily; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCE40302.1|GH0	0.0	1	1051	1	1051
CCG22169.1|GH0	0.0	1	1051	1	1051
QWW23957.1|GH0	0.0	4	1364	8	1417
AOW28369.1|GH0	0.0	1	1048	3	1045
ABN64925.2|GH0	0.0	4	1046	5	1043

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2MJD_A	9.01e-58	1251	1364	2	115	Oxidized Yeast Adrenodoxin Homolog 1 [Saccharomyces cerevisiae S288C],2MJE_A Reduced Yeast Adrenodoxin Homolog 1 [Saccharomyces cerevisiae S288C]
2MJ3_A	9.81e-37	1255	1358	4	110	Backbone 1H, 13C, and 15N Chemical Shift Assignments and structure of Iron-sulfur cluster binding protein from Ehrlichia chaffeensis [Ehrlichia chaffeensis str. Arkansas]
2WLB_A	1.07e-35	1253	1352	4	103	Adrenodoxin-like ferredoxin Etp1fd(516-618) of Schizosaccharomyces pombe mitochondria [Schizosaccharomyces pombe],2WLB_B Adrenodoxin-like ferredoxin Etp1fd(516-618) of Schizosaccharomyces pombe mitochondria [Schizosaccharomyces pombe]
3N9Y_C	3.67e-25	1248	1352	1	107	Crystal structure of human CYP11A1 in complex with cholesterol [Homo sapiens],3N9Y_D Crystal structure of human CYP11A1 in complex with cholesterol [Homo sapiens]
3N9Z_C	4.79e-25	1248	1352	1	107	Crystal structure of human CYP11A1 in complex with 22-hydroxycholesterol [Homo sapiens],3N9Z_D Crystal structure of human CYP11A1 in complex with 22-hydroxycholesterol [Homo sapiens],3NA1_C Crystal structure of human CYP11A1 in complex with 20-hydroxycholesterol [Homo sapiens],3NA1_D Crystal structure of human CYP11A1 in complex with 20-hydroxycholesterol [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q04336|YM54_YEAST	0.0	5	967	12	1000	Uncharacterized protein YMR196W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YMR196W PE=1 SV=1
sp|Q12184|ADRX_YEAST	3.00e-56	1251	1364	59	172	Adrenodoxin homolog, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YAH1 PE=1 SV=1
sp|Q9AKC4|FER2_RICTY	1.80e-35	1250	1363	2	115	2Fe-2S ferredoxin OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) OX=257363 GN=fdxB PE=3 SV=1
sp|Q9AKH1|FER2_RICRI	2.10e-35	1252	1359	4	111	2Fe-2S ferredoxin OS=Rickettsia rickettsii OX=783 GN=fdxB PE=3 SV=1
sp|Q92J08|FER2_RICCN	2.87e-35	1252	1359	4	111	2Fe-2S ferredoxin OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) OX=272944 GN=fdxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000001

TMHMM  Annotations     

There is no transmembrane helices in KAG5421492.1.