CAZyme Information: KAG5419742.1

Basic Information

• Species: Candida metapsilosis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida metapsilosis
• CAZyme ID: KAG5419742.1
• CAZy Family: GH76
• CAZyme Description: och1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
408	JAEOAQ010000002|CGC7	46505.54	9.1089

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CmetapsilosisBP57	5743	N/A	17	5726

• Gene Location: location=JAEOAQ010000002:267058-268284(+)

Full Sequence      

MPKYHGSSNNKGRKILIVTTLVSLILLGIAFFSGFLSQSKDLQGVISSLPNDKLLGLSNF
LSSENSKNQDELLSKIEKLNKKLFQAQEAKINKLEEQNKLILKELKLLKHPPSSASVRDK
LTFLYPYDSESKFPAYIWQSWKHGLNDDRFDEKYRQGESQWAFKNPGFVHELFNDDTAHT
VIKYLYSQVPEVIETFELLPETIMKMDFFKYLILYAKGGVYADIDTFPLQPIPNWTPENV
SPLDIGVILAIESDSSSPDWRKEQIHRLQFGQFVIQAKPGHPILREAIAVIVEQTRLKKL
EGLAASGGGPLKLIGNSNEKLLKISQWTGSGLWTDVVFKYFNDYIQSSVFQKVTWKEFHK
LQTPKLVSDILVLPVKSFASDIEEPKDGKIEDPLAFVKHYAAKIWRNG

Enzyme Prediction     

No EC number prediction in KAG5419742.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	155	238	1.9e-20	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.32e-37	118	402	67	343	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	2.49e-18	161	242	11	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCE39846.1|GT32	4.74e-255	1	408	23	431
CCG24586.1|GT32	3.54e-249	1	408	1	408
ABN66691.2|GT32	6.72e-192	9	406	7	400
CCE86889.1|GT32	1.32e-174	11	407	6	399
CAG89506.2|GT32	6.20e-173	10	406	4	398

PDB Hits     

KAG5419742.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P47124|HOC1_YEAST	4.27e-104	16	407	14	389	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q5A4E3|OCH1_CANAL	1.27e-69	112	407	78	377	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	1.48e-50	116	406	79	470	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q9UTR6|OCH1_SCHPO	5.45e-48	118	407	129	395	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.924953	0.075058

TMHMM  Annotations     

Start	End
15	37