CAZyme Information: KAG5418871.1

Basic Information

• Species: Candida metapsilosis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida metapsilosis
• CAZyme ID: KAG5418871.1
• CAZy Family: GH37
• CAZyme Description: BGL2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
308	JAEOAQ010000004|CGC1	33779.46	4.0656

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CmetapsilosisBP57	5743	N/A	17	5726

• Gene Location: location=JAEOAQ010000004:441037-442058(+)

Full Sequence      

MQFNLLSALVAGLATANAIGDLAFNLGVKDNSGNCKTVDEFKSDLELISGSSKIIKTYAV
SDCNTLQNLGPAAEAEGFQIMLGIWPTDDSHFEAEKQALQQYLTQISTSTIKIFLVGSEA
LYRNDLTADQLSDKINDIKDLVKDIKDKDGNSYSSVPVGTVDSWNVLVDGGAKPAIQTAD
VVYANAFSYWQGQTNQNASYSFFDDIMQALQTIQTVKGSTDIEFWVGETGWPTDGSNFES
SQPGVENAKNFWQNAICAMRGWGVNVAVFEAIDEAWKPDTSGINDVEKHWGVWDANNKLK
YEINCNFD

Enzyme Prediction     

EC	3.2.1.39:6	3.2.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	23	305	2e-45	0.9935691318327974

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
366033	Glyco_hydro_17	4.15e-106	22	305	1	309	Glycosyl hydrolases family 17.
227625	Scw11	8.93e-101	16	296	40	304	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCG23752.1|GH17	4.64e-222	1	308	1	308
CCE44358.1|GH17	2.03e-216	1	308	1	308
CAG90862.1|GH17	2.03e-172	1	307	1	306
CAY05231.1|GH17	2.03e-172	1	307	1	306
QFZ46728.1|GH17	1.16e-169	1	307	1	307

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	1.46e-34	25	300	41	289	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	1.09e-33	25	300	41	289	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AMT2|BGL2_CANAL	7.86e-166	1	308	1	308	Glucan 1,3-beta-glucosidase BGL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BGL2 PE=1 SV=2
sp|P43070|BGL2_CANAX	1.51e-163	1	308	1	308	Glucan 1,3-beta-glucosidase OS=Candida albicans OX=5476 GN=BGL2 PE=3 SV=1
sp|P15703|BGL2_YEAST	1.27e-149	7	307	12	312	Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BGL2 PE=1 SV=1
sp|O13990|BGL2_SCHPO	2.38e-85	7	305	27	318	Glucan 1,3-beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bgl2 PE=2 SV=4
sp|D4B2W4|BGL2_ARTBC	2.68e-61	8	305	10	301	Glucan 1,3-beta-glucosidase ARB_02797 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02797 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000393	0.999563	CS pos: 18-19. Pr: 0.9606

TMHMM  Annotations     

There is no transmembrane helices in KAG5418871.1.